Sequence 1: | NP_650658.1 | Gene: | CG17806 / 42142 | FlyBaseID: | FBgn0038548 | Length: | 421 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001371833.1 | Gene: | ZNF517 / 340385 | HGNCID: | 27984 | Length: | 492 | Species: | Homo sapiens |
Alignment Length: | 317 | Identity: | 88/317 - (27%) |
---|---|---|---|
Similarity: | 118/317 - (37%) | Gaps: | 80/317 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 164 PQLSSDYPVESMNHEEPASEMPQVMKEE---------PRTLQVIG------------EVQKNRRK 207
Fly 208 PRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKR---AYALEHRL------YFCD 263
Fly 264 QCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDN 328
Fly 329 CLKRLNHERNHKESPVH--------------------RPHVCSTCQKAFKTSTALKDHIVVHTGE 373
Fly 374 QPFHCELCQTFFNRRNALATHYK-----------------------SKHHRLKVEEQ 407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17806 | NP_650658.1 | zf-AD | 4..76 | CDD:285071 | |
zf-C2H2 | 260..282 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 290..311 | CDD:275368 | 8/20 (40%) | ||
COG5048 | <298..>383 | CDD:227381 | 34/104 (33%) | ||
C2H2 Zn finger | 319..339 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 350..370 | CDD:275368 | 5/19 (26%) | ||
ZnF_U1 | 375..407 | CDD:197732 | 12/54 (22%) | ||
C2H2 Zn finger | 378..396 | CDD:275368 | 6/17 (35%) | ||
ZNF517 | NP_001371833.1 | KRAB | 14..73 | CDD:214630 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 129..170 | 10/30 (33%) | |||
C2H2 Zn finger | 180..199 | CDD:275368 | 2/18 (11%) | ||
COG5048 | <203..342 | CDD:227381 | 50/143 (35%) | ||
C2H2 Zn finger | 207..227 | CDD:275368 | 5/21 (24%) | ||
C2H2 Zn finger | 235..255 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 263..283 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <287..459 | CDD:227381 | 48/165 (29%) | ||
C2H2 Zn finger | 291..311 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 319..339 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 398..418 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 426..446 | CDD:275368 | 2/19 (11%) | ||
C2H2 Zn finger | 454..474 | CDD:275368 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 472..492 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |