DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG15436

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:418 Identity:104/418 - (24%)
Similarity:160/418 - (38%) Gaps:92/418 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTLCRTCGQEAEHAKSLFDKEAR---DVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAF 62
            |..:||.|...:....::||...|   .:...|.:.|||.::........||..|..|:..|...
  Fly     1 MAEICRVCMDISGKLVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAYGI 65

  Fly    63 RERCIRTNSSW--FEKQGKQ-------EDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQ 118
            |:.|..::..:  ...:|.:       |:.|.|.:.:.     ::|:|  ..|.|....:    .
  Fly    66 RQTCEESHQFYCRVRDEGIEDALCALLEEEDWEISEDE-----DARID--SASAADDDGK----S 119

  Fly   119 RSKKVDGVPLKTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASE 183
            .||||                           ...|.   :...:.|....:......|.:..|.
  Fly   120 DSKKV---------------------------AFECR---ECHKKYQRKGTFLRHMRTHMDGQSF 154

  Fly   184 MPQVMKEEPRTLQVIGEVQK--NRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKW 246
            .....|...|....:....|  |..||      .||            |...||    :|.::..
  Fly   155 PCPYCKRNFRLRVTLKAHMKTHNAAKP------YEC------------SHCAKT----FAQQSTL 197

  Fly   247 GAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQ--HLLNLHVRI 309
            .:.:|.:..| |.:.|.||.|||.:..:...|:|.|...:.|:|.:|.: .||:  ||.| |.| 
  Fly   198 QSHERTHTGE-RPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTK-TFTRKFHLDN-HFR- 258

  Fly   310 KHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVH---RPHVCSTCQKAFKTSTALKDHIVVHT 371
            .|.||.|:.|.:|.|.|  .:|:  |.:.|  |.:|   ||..||.|.|.|:.|:.||:|.:||.
  Fly   259 SHTGERPFKCSHCPKAF--AMKQ--HLKQH--SRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHN 317

  Fly   372 GEQPFHCELCQTFFNRRNALATHYKSKH 399
            .|:.|.|..|.:|:.:|..||.|....|
  Fly   318 AERTFKCPHCASFYKQRKTLARHILEIH 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 17/76 (22%)
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 9/22 (41%)
COG5048 <298..>383 CDD:227381 37/89 (42%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 9/19 (47%)
ZnF_U1 375..407 CDD:197732 9/25 (36%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 17/73 (23%)
C2H2 Zn finger 128..148 CDD:275368 2/22 (9%)
C2H2 Zn finger 156..176 CDD:275368 3/19 (16%)
COG5048 <180..341 CDD:227381 64/192 (33%)
C2H2 Zn finger 184..204 CDD:275368 6/35 (17%)
zf-H2C2_2 197..219 CDD:290200 7/22 (32%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 7/25 (28%)
C2H2 Zn finger 240..260 CDD:275368 9/22 (41%)
zf-H2C2_2 252..276 CDD:290200 13/27 (48%)
C2H2 Zn finger 268..288 CDD:275368 8/25 (32%)
C2H2 Zn finger 296..316 CDD:275368 9/19 (47%)
C2H2 Zn finger 324..341 CDD:275368 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.