DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG31441

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:411 Identity:102/411 - (24%)
Similarity:170/411 - (41%) Gaps:84/411 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTLCRTCGQEAEH----AKSLFDKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIA 61
            :.::|||||:...:    |..||:|.....:|.:..:|..:|.....:|..||..|.:.|:..:.
  Fly     4 LRSICRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYLEFDTTLPHLICQCCKVQLDRILT 68

  Fly    62 FRERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGV 126
            ||.:|:..:.|:.                ..|.:|             .:::.|:.:...|.|  
  Fly    69 FRNKCLEVHKSFM----------------AANRKL-------------LRKKAIVDEELDKPD-- 102

  Fly   127 PLKTVETPIYPLVVPE--IPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMK 189
             ::.::..::.....|  :..||....|| ||    .::.:.:.| ..::..:|:...|..||..
  Fly   103 -VEKLQQDLWDHTDQEMCVAMADTAGLLR-ED----HNDNEKAKD-AEDATQNEKNQEEQVQVQT 160

  Fly   190 EEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYA 254
            ||....|    .|.:.....|||.....|              .:||      ||.         
  Fly   161 EEVEHCQ----EQLHNMSIISKGVSARVP--------------KRTK------RNS--------- 192

  Fly   255 LEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVC 319
               :.:||||||..|.......:||:||.|.|.|.|..|....:|.:.:..| ||.|....||.|
  Fly   193 ---KSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRH-RILHTDARPYAC 253

  Fly   320 KYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTF 384
            ::|.|.:..|..::.|||.|..   .||..|..|.|||.:::..:.|.::||.::.:|||:|..:
  Fly   254 RFCSKTYRGCSSKVVHERTHTN---ERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQW 315

  Fly   385 FNRRNALATHYKSKHHRLKVE 405
            |.|.:.|..|..:|.|:.:.|
  Fly   316 FLRSSHLTLHQSTKLHQRRAE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 21/75 (28%)
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 29/84 (35%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 11/31 (35%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 21/90 (23%)
COG5048 <174..337 CDD:227381 60/199 (30%)
C2H2 Zn finger 197..217 CDD:275370 8/19 (42%)
C2H2 Zn finger 225..245 CDD:275368 6/20 (30%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 268..290 CDD:290200 11/24 (46%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..328 CDD:275368 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.