DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF354C

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_055409.1 Gene:ZNF354C / 30832 HGNCID:16736 Length:554 Species:Homo sapiens


Alignment Length:405 Identity:93/405 - (22%)
Similarity:165/405 - (40%) Gaps:77/405 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LLDLNDAIAFRERCI-RTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDV-MPISIAQPQR--- 112
            ||...:.:.||:..: .:...|......|.....|...|..::.:...:.. ||..|.|.|:   
Human     5 LLSAQEPVTFRDVAVFFSQDEWLHLDSAQRALYREVMLENYSSLVSLGIPFSMPKLIHQLQQGED 69

  Fly   113 ----RRILPQRSKKVDGVPLKT-VETPIYP----LVVPE-----IPPADLVD---PLRCEDPIQV 160
                .|.:|..::    :..|| :||...|    :.:.|     :....:.|   .:..|:.::.
Human    70 PCMVEREVPSDTR----LGFKTWLETEALPHRQDIFIEETSQGMVKKESIKDGHWDINFEEAVEF 130

  Fly   161 KSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIG-----EVQKNRRKPRSKGCLEECPGK 220
            :||        :|....::|   :.|::....:|:...|     |:.|:.....:....:..|  
Human   131 ESE--------IEEEQEKKP---LRQMIDSHEKTISEDGNHTSLELGKSLFTNTALVTQQSVP-- 182

  Fly   221 DMAKIENIDSTTNKTKEEKYATR--------------NKWGAA--KRAYALEH-------RLYFC 262
             :.:|.|:..|..|..::.:...              |:.|.:  :..:.:||       :.|.|
Human   183 -IERIPNMYYTFGKDFKQNFDLMKCFQIYPGGKPHICNECGKSFKQNLHLIEHQRIHTGEKPYKC 246

  Fly   263 DQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFD 327
            ::|.||||.:.:...|.|.|.|.|.::|.||::.......|..|:|: |.||.||.|:.|||.|.
Human   247 NECEKTFSHRSSLLSHQRIHTGEKPYKCNECEKAFSNSSTLIKHLRV-HTGEKPYRCRECGKAFS 310

  Fly   328 NCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALA 392
            .|.....|:|.|....:::   |..|:|||.....|..|..:||||:|:.|..|...:::..:||
Human   311 QCSTLTVHQRIHTGEKLYK---CGECEKAFNCRAKLHRHQRIHTGEKPYKCSECGKGYSQFTSLA 372

  Fly   393 THYKSKHHRLKVEEQ 407
                 :|.|....||
Human   373 -----EHQRFHTGEQ 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 5/23 (22%)
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 31/84 (37%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 7/31 (23%)
C2H2 Zn finger 378..396 CDD:275368 4/17 (24%)
ZNF354CNP_055409.1 KRAB 12..72 CDD:214630 11/59 (19%)
KRAB 12..51 CDD:279668 6/38 (16%)
C2H2 Zn finger 194..210 CDD:275368 1/15 (7%)
C2H2 Zn finger 218..238 CDD:275368 4/19 (21%)
zf-H2C2_2 230..255 CDD:290200 8/24 (33%)
COG5048 242..>541 CDD:227381 52/150 (35%)
C2H2 Zn finger 246..266 CDD:275368 8/19 (42%)
zf-H2C2_2 258..283 CDD:290200 8/24 (33%)
C2H2 Zn finger 274..294 CDD:275368 6/20 (30%)
zf-H2C2_2 287..311 CDD:290200 13/24 (54%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
zf-H2C2_2 315..339 CDD:290200 8/26 (31%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
zf-H2C2_2 345..367 CDD:290200 8/21 (38%)
C2H2 Zn finger 358..378 CDD:275368 6/24 (25%)
C2H2 Zn finger 386..406 CDD:275368
zf-H2C2_2 399..423 CDD:290200
C2H2 Zn finger 414..434 CDD:275368
C2H2 Zn finger 442..462 CDD:275368
zf-H2C2_2 454..479 CDD:290200
C2H2 Zn finger 470..490 CDD:275368
zf-H2C2_2 483..507 CDD:290200
C2H2 Zn finger 498..518 CDD:275368
C2H2 Zn finger 526..544 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.