DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF621

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001091884.1 Gene:ZNF621 / 285268 HGNCID:24787 Length:439 Species:Homo sapiens


Alignment Length:160 Identity:53/160 - (33%)
Similarity:70/160 - (43%) Gaps:26/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 CDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRF 326
            |.:|||.|....:..||.:.|.|...::|:||.:...:...|..|.|| |.||.||.||.|||.|
Human   181 CKECGKAFKSSYDCIVHE
KNHIGEGPYECKECGKGLSSNTALTQHQRI-HTGEKPYECKECGKAF 244

  Fly   327 DNCLKRLNHERNH--------KE--------------SPVH---RPHVCSTCQKAFKTSTALKDH 366
            ......|.|:|.|        ||              ..:|   :|:.|..|.|||....|...|
Human   245 RRSAAYLQHQRLHTGEKLYKCKECWKAFGCRSLFIVHQRIHTGEKPYQCKECGKAFTQKIASIQH 309

  Fly   367 IVVHTGEQPFHCELCQTFFNRRNALATHYK 396
            ..|||||:|:.|::|...|....:...|.|
Human   310 QRVHTGEKPYECKVCGKAFKWYGSFVQHQK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 7/19 (37%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 38/109 (35%)
C2H2 Zn finger 319..339 CDD:275368 9/19 (47%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 6/22 (27%)
C2H2 Zn finger 378..396 CDD:275368 4/17 (24%)
ZNF621NP_001091884.1 KRAB 11..71 CDD:214630
COG4049 145..198 CDD:226535 6/16 (38%)
C2H2 Zn finger 153..173 CDD:275368
zf-H2C2_2 166..190 CDD:316026 5/8 (63%)
C2H2 Zn finger 209..229 CDD:275368 7/20 (35%)
zf-H2C2_2 221..246 CDD:316026 15/25 (60%)
C2H2 Zn finger 237..257 CDD:275368 9/19 (47%)
C2H2 Zn finger 265..285 CDD:275368 2/19 (11%)
zf-H2C2_2 281..302 CDD:316026 7/20 (35%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-H2C2_2 308..329 CDD:316026 9/20 (45%)
C2H2 Zn finger 321..341 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.