DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF285

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001278417.1 Gene:ZNF285 / 26974 HGNCID:13079 Length:597 Species:Homo sapiens


Alignment Length:303 Identity:85/303 - (28%)
Similarity:122/303 - (40%) Gaps:78/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PLRCEDPIQVKSEPQLSS-DYPVESM--------------NHEEPASEMPQVMKE-----EPRTL 195
            |:.|:....:....::|| |.|.:..              :|.....|||....|     ..|:|
Human   301 PMGCKQSSDLPRYQKVSSGDKPYKCKECGKGFRRSSSLHNHHRVHTGEMPYKCDECGKGFGFRSL 365

  Fly   196 QVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLY 260
            ..|.:.....:||..  | ||| ||      ..|.::|....::..|..|             .|
Human   366 LCIHQGVHTGKKPYK--C-EEC-GK------GFDQSSNLLVHQRVHTGEK-------------PY 407

  Fly   261 FCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQ--HLLNLHVRIKHRGELPYVCKYCG 323
            .|.:|||.||......||.|.|.|.|.::|.||.: .|:|  | |::|.|: |.||.||.|..||
Human   408 KCSECGKCFSSSSVLQVHWRFHTGEKPYRCGECGK-GFSQCTH-LHIHQRV-HTGEKPYKCNVCG 469

  Fly   324 KRFDNCLKRLNHERNHK-ESP-----------------VH-------RPHVCSTCQKAFKTSTAL 363
            |.|........|:|.|. |.|                 :|       :|:.|..|.|.|..::.|
Human   470 KDFAYSSVLHTHQRVHTGEKPYKCEVCGKCFSYSSYFHLHQRDHIREKPYKCDECGKGFSRNSDL 534

  Fly   364 KDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHRLKVEE 406
            ..|:.|||||:|:.|:.|...|:|.:     |...|.|:.::|
Human   535 NVHLRVHTGERPYKCKACGKGFSRNS-----YLLAHQRVHIDE 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 10/21 (48%)
C2H2 Zn finger 262..282 CDD:275368 9/19 (47%)
C2H2 Zn finger 290..311 CDD:275368 9/22 (41%)
COG5048 <298..>383 CDD:227381 37/111 (33%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 9/32 (28%)
C2H2 Zn finger 378..396 CDD:275368 4/17 (24%)
ZNF285NP_001278417.1 KRAB 15..54 CDD:279668
KRAB 15..>52 CDD:214630
C2H2 Zn finger 214..233 CDD:275368
COG5048 236..569 CDD:227381 84/298 (28%)
C2H2 Zn finger 241..261 CDD:275368
C2H2 Zn finger 269..289 CDD:275368
zf-C2H2 323..345 CDD:278523 1/21 (5%)
C2H2 Zn finger 325..345 CDD:275368 1/19 (5%)
C2H2 Zn finger 353..373 CDD:275368 4/19 (21%)
C2H2 Zn finger 381..401 CDD:275368 8/27 (30%)
zf-H2C2_2 393..418 CDD:290200 9/37 (24%)
C2H2 Zn finger 409..429 CDD:275368 9/19 (47%)
C2H2 Zn finger 437..457 CDD:275368 9/22 (41%)
zf-H2C2_2 453..474 CDD:290200 12/21 (57%)
C2H2 Zn finger 465..485 CDD:275368 7/19 (37%)
zf-H2C2_2 480..502 CDD:290200 5/21 (24%)
C2H2 Zn finger 493..513 CDD:275368 1/19 (5%)
zf-C2H2 519..541 CDD:278523 6/21 (29%)
C2H2 Zn finger 521..541 CDD:275368 6/19 (32%)
zf-H2C2_2 533..558 CDD:290200 11/24 (46%)
C2H2 Zn finger 549..569 CDD:275368 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.