DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF500

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_067678.1 Gene:ZNF500 / 26048 HGNCID:23716 Length:480 Species:Homo sapiens


Alignment Length:446 Identity:105/446 - (23%)
Similarity:155/446 - (34%) Gaps:124/446 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDVLSNILKLTGFWLRNQPGVPTRICLSCLLDL-----------------------NDAIAFRER 65
            |:.||.:.:|...|||  |.:.|:..:..||.|                       .:|:...|.
Human    65 REALSRLWELCCRWLR--PELRTKEQILELLVLEQFLTVLPGEIQARVREQQPESGEEAVVLVEG 127

  Fly    66 CIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIA------------------QPQR 112
             ::.......::|.:..||.|.....|...|:.:.:..|..::                  :|||
Human   128 -LQRKPRKHRQRGSELLSDDEVPLGIGGQFLKHQAEAQPEDLSLEEEARFSSQQPPAQLSHRPQR 191

  Fly   113 RRIL-PQRSKKV----------------DGVPLKTVETPIYPLVVPEIPPADLVDPLRCEDPIQV 160
            ..:| |:|....                ..||:...:..:|  :..|.|        ||.||.| 
Human   192 GPLLWPERGPPAPRHQEMASASPFLSAWSQVPVNLEDVAVY--LSGEEP--------RCMDPAQ- 245

  Fly   161 KSEPQLSSDYPVESMNHEEPASEMPQ---------VMKEEPRTLQVIGEVQKNRRKPRSKGCLEE 216
                   .|.|:|   :|.|..::..         :..|..|.|..           |.:|....
Human   246 -------RDAPLE---NEGPGIQLEDGGDGREDAPLRMEWYRVLSA-----------RCQGPGHP 289

  Fly   217 CPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRR 281
            .||:..|.:..:..............|...||.|.        |.|.:|||.||:..:...|.|.
Human   290 LPGQRPAPVRGLVRPDQPRGGPPPGRRASHGADKP--------YTCPECGKGFSKTSHLTKHQRT 346

  Fly   282 HKGTKEFQCQEC-----DRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKE 341
            |.|.:.::|..|     ||..|     :.|.|: |.||.||.|..|||||......:.|.|.|..
Human   347 HTGERPYKCLVCGKGFSDRSNF-----STHQRV-HTGEKPYPCPECGKRFSQSSSLVIHRRTHSG 405

  Fly   342 SPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKS 397
               .||:.|:.|.|.|..|:....|...||||:|:.|..|...|.|...|..|.::
Human   406 ---ERPYACTQCGKRFNNSSHFSAHRRTHTGEKPYTCPACGRGFRRGTDLHKHQRT 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 14/74 (19%)
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 7/25 (28%)
COG5048 <298..>383 CDD:227381 32/84 (38%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 7/23 (30%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
ZNF500NP_067678.1 SCAN 46..151 CDD:128708 18/88 (20%)
SCAN 46..134 CDD:280241 14/71 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208 7/46 (15%)
KRAB_A-box 224..>247 CDD:143639 8/40 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..268 8/36 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..322 6/37 (16%)
COG5048 <320..459 CDD:227381 54/156 (35%)
zf-C2H2 325..347 CDD:278523 9/21 (43%)
C2H2 Zn finger 327..347 CDD:275368 8/19 (42%)
zf-H2C2_2 339..363 CDD:290200 6/23 (26%)
C2H2 Zn finger 355..375 CDD:275368 7/25 (28%)
zf-H2C2_2 367..392 CDD:290200 14/30 (47%)
C2H2 Zn finger 383..403 CDD:275368 8/19 (42%)
zf-H2C2_2 395..420 CDD:290200 9/27 (33%)
C2H2 Zn finger 411..431 CDD:275368 6/19 (32%)
zf-H2C2_2 423..448 CDD:290200 9/24 (38%)
C2H2 Zn finger 439..459 CDD:275368 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 453..480 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.