DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and sfc2

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_594670.1 Gene:sfc2 / 2542887 PomBaseID:SPAC144.09c Length:374 Species:Schizosaccharomyces pombe


Alignment Length:306 Identity:71/306 - (23%)
Similarity:98/306 - (32%) Gaps:120/306 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 KNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQ--C 265
            ||.|..:.   :..||.::..|              ||:..:......|.::.| |.:.||.  |
pombe    14 KNLRSAKK---IFHCPYEECGK--------------KYSRPSLLEQHLRTHSNE-RPFVCDYTGC 60

  Fly   266 GKTFSEKGNFNVHLRRHKGTKEFQC--QECDRMEFTQHLLNLHVRIK------------------ 310
            .|.|..|.:..:|.|.|...|.|.|  ..||...:||..|..|:.:.                  
pombe    61 SKAFYRKSHLKIHKRCHTNVKPFSCHYDGCDAQFYTQQHLERHIEVHRKPKPYACTWEGCDECFS 125

  Fly   311 ------------HRGELPYVCKY--CGKRFDNCLKRLNH-ERNHK-------------------- 340
                        |...|||.|.|  |..||....|..|| .|.|:                    
pombe   126 KHQQLRSHISACHTHLLPYPCTYQDCELRFATKQKLQNHVNRAHEKIISYSCPHESCVGHEGFEK 190

  Fly   341 ----ESPVHRPHV--CSTCQKAFKT----------------------------------STALKD 365
                ::.:...||  ||.|.:.|||                                  |:|||.
pombe   191 WSQLQNHIREAHVPSCSICGRQFKTAAHLRHHVVLHQTTLEERKTYHCPMEGCKKSFTRSSALKK 255

  Fly   366 HI-VVHTGEQPFHCELCQTFFNRRNALATHYK----SKHHRLKVEE 406
            || |:|.|...|||:.|.|.|..::.|..|.:    .|.|:..:.|
pombe   256 HISVIHEGNMAFHCDSCGTKFGYKHMLQRHLERGTCKKAHKPYINE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 8/23 (35%)
C2H2 Zn finger 262..282 CDD:275368 8/21 (38%)
C2H2 Zn finger 290..311 CDD:275368 7/52 (13%)
COG5048 <298..>383 CDD:227381 39/178 (22%)
C2H2 Zn finger 319..339 CDD:275368 9/22 (41%)
C2H2 Zn finger 350..370 CDD:275368 13/54 (24%)
ZnF_U1 375..407 CDD:197732 11/36 (31%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
sfc2NP_594670.1 COG5048 1..374 CDD:227381 71/306 (23%)
C2H2 Zn finger 28..47 CDD:275368 4/32 (13%)
C2H2 Zn finger 55..77 CDD:275368 8/21 (38%)
C2H2 Zn finger 85..107 CDD:275368 7/21 (33%)
C2H2 Zn finger 115..138 CDD:275368 0/22 (0%)
C2H2 Zn finger 146..165 CDD:275368 7/18 (39%)
C2H2 Zn finger 206..226 CDD:275368 6/19 (32%)
C2H2 Zn finger 238..261 CDD:275368 7/22 (32%)
C2H2 Zn finger 269..286 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.