DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and prz1

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_593073.1 Gene:prz1 / 2541806 PomBaseID:SPAC4G8.13c Length:681 Species:Schizosaccharomyces pombe


Alignment Length:413 Identity:94/413 - (22%)
Similarity:133/413 - (32%) Gaps:120/413 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DVLSNILKLTGFWLRNQPGVPTRICLSCLL------DLNDAIAFRERCIRTNSSWFEKQGKQEDS 83
            |:||| .....|...|.|........|..|      .||...| ||..||:.:|.|    .::.:
pombe   319 DLLSN-HSTPSFIFENSPSAEFSHQSSPYLVPNSGRTLNSENA-RESTIRSVNSPF----SEDHA 377

  Fly    84 DTETAREGGNNRLESRV--DVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLVVPEIPPA 146
            |..         |.:.|  .:.|.:::    ..:|...|....|.|...        |||..|..
pombe   378 DAS---------LTTHVFDPISPTALS----NSVLNYDSNNFSGTPQIN--------VVPSSPSK 421

  Fly   147 DLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQ-------VIGEVQKN 204
            ....|       .:.:.|.|.:|..:.......|.|..| .|.|....||       .:......
pombe   422 SQSGP-------SLPANPLLQTDISITYSQSASPVSGQP-AMNENSYDLQNANLCAPEMSPTYTA 478

  Fly   205 RRKPRSKG---------------------CLEECPGKD-MAKIENIDSTTNKTKEEKYATRNKWG 247
            |.:..|.|                     ||......: :.||||.:|.:|    :..:.||   
pombe   479 RHRSNSAGSRFDAYEPIPQLYTHFSHSSECLSVNQDTELLGKIENDNSKSN----DYLSVRN--- 536

  Fly   248 AAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHR 312
            ...|:.:|.             |..||.:.:....|...|                     .|.:
pombe   537 TRPRSRSLN-------------SLVGNKSENSSSSKAKSE---------------------SKSQ 567

  Fly   313 GELPYVCKY--CGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQP 375
            |.  |||.:  |.|||.......:|...|..   :||..||.|:|:|......:.|..:|||.:.
pombe   568 GN--YVCTFAGCNKRFTRAYNLKSHMNTHTN---YRPFQCSICKKSFARQHDKRRHEQLHTGIKA 627

  Fly   376 FHCELCQTFFNRRNALATHYKSK 398
            |.|..|...|.|.:||..||||:
pombe   628 FACVTCNQRFARMDALNRHYKSE 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 18/56 (32%)
zf-C2H2 260..282 CDD:278523 3/21 (14%)
C2H2 Zn finger 262..282 CDD:275368 3/19 (16%)
C2H2 Zn finger 290..311 CDD:275368 0/20 (0%)
COG5048 <298..>383 CDD:227381 25/86 (29%)
C2H2 Zn finger 319..339 CDD:275368 6/21 (29%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 11/24 (46%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
prz1NP_593073.1 COG5048 121..620 CDD:227381 80/381 (21%)
zf-C2H2 570..594 CDD:278523 8/23 (35%)
C2H2 Zn finger 577..594 CDD:275368 5/16 (31%)
zf-H2C2_2 586..611 CDD:290200 9/27 (33%)
C2H2 Zn finger 602..622 CDD:275368 6/19 (32%)
zf-H2C2_2 616..639 CDD:290200 8/22 (36%)
C2H2 Zn finger 630..648 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.