Sequence 1: | NP_650658.1 | Gene: | CG17806 / 42142 | FlyBaseID: | FBgn0038548 | Length: | 421 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016861553.1 | Gene: | ZNF620 / 253639 | HGNCID: | 28742 | Length: | 467 | Species: | Homo sapiens |
Alignment Length: | 345 | Identity: | 86/345 - (24%) |
---|---|---|---|
Similarity: | 133/345 - (38%) | Gaps: | 82/345 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 PLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYP-VESMNHEEPASEMPQVMKEEPRTLQVIGE 200
Fly 201 VQKNRRKPRSKG-CLEECPG----KDMAKIENIDSTTNKTKEEKYATRN--KWGAAKRAYALEHR 258
Fly 259 L------------YFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDR-MEFTQHLLN------ 304
Fly 305 ---------------------LHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNH--------- 339
Fly 340 ---------KESPVH-------RPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRR 388
Fly 389 NALATHYK----SKHHRLKV 404 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17806 | NP_650658.1 | zf-AD | 4..76 | CDD:285071 | |
zf-C2H2 | 260..282 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 290..311 | CDD:275368 | 7/48 (15%) | ||
COG5048 | <298..>383 | CDD:227381 | 37/136 (27%) | ||
C2H2 Zn finger | 319..339 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 350..370 | CDD:275368 | 7/19 (37%) | ||
ZnF_U1 | 375..407 | CDD:197732 | 11/34 (32%) | ||
C2H2 Zn finger | 378..396 | CDD:275368 | 6/17 (35%) | ||
ZNF620 | XP_016861553.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |