DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZSCAN23

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001012458.1 Gene:ZSCAN23 / 222696 HGNCID:21193 Length:389 Species:Homo sapiens


Alignment Length:415 Identity:99/415 - (23%)
Similarity:159/415 - (38%) Gaps:87/415 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TCGQEA------EHAKSLFDKE-----------ARDVLSNILKLTGFWLRNQPGVPTRICLSCLL 54
            :||.|:      .|.:.:|.:.           .|:.|..:.:|...|||  |.:.|:..:..||
Human    29 SCGPESGLSRNNPHTREIFRRRFRQFCYQESPGPREALQRLQELCHQWLR--PEMHTKEQILELL 91

  Fly    55 DLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRVD---VMPISIAQPQ----R 112
            .|...:......::   :|..:.......:..|..|.    ||..:|   ...:|.|..|    :
Human    92 VLEQFLTILPEELQ---AWVRQHRPVSGEEAVTVLED----LERELDDPGEQVLSHAHEQEEFVK 149

  Fly   113 RRILPQRSKKVDGVPLKTVETPI-YPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMN 176
            .:..|..:::......:|:|..: |.|  .|:.|...:|              ..:..:.||.  
Human   150 EKATPGAAQESSNDQFQTLEEQLGYNL--REVCPVQEID--------------GKAGTWNVEL-- 196

  Fly   177 HEEPASEMPQVMKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYA 241
              .|..|:.|.:|.   .:||:|         :..|.:.:.|       |..|:...:.:.||  
Human   197 --APKREISQEVKS---LIQVLG---------KQNGNITQIP-------EYGDTCDREGRLEK-- 238

  Fly   242 TRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLH 306
                    :|..:...|.|.|.:|||:|::......|.|.|.|.|.::|.||.|....:..|..|
Human   239 --------QRVSSSVERPYICSECGKSFTQNSILIEHQRTHTGEKPYECDECGRAFSQRSGLFQH 295

  Fly   307 VRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHT 371
            .|: |.||..|.|..|||.|.......:|.|.|..   .:|:.|:.|.|:|...:.|..|..:||
Human   296 QRL-HTGEKRYQCSVCGKAFSQNAGLFHHLRIHTG---EKPYQCNQCNKSFSRRSVLIKHQRIHT 356

  Fly   372 GEQPFHCELCQTFFNRRNALATHYK 396
            ||:|:.||.|...|.....|..|.|
Human   357 GERPYECEECGKNFIYHCNLIQHRK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 17/85 (20%)
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 30/84 (36%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 8/22 (36%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
ZSCAN23NP_001012458.1 SCAN 44..156 CDD:128708 22/120 (18%)
SCAN 45..132 CDD:280241 17/95 (18%)
COG5048 <215..384 CDD:227381 57/188 (30%)
zf-C2H2 249..271 CDD:278523 8/21 (38%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
zf-H2C2_2 264..288 CDD:290200 9/23 (39%)
C2H2 Zn finger 279..299 CDD:275368 7/20 (35%)
zf-H2C2_2 292..316 CDD:290200 12/24 (50%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
zf-H2C2_2 323..344 CDD:290200 8/23 (35%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
zf-H2C2_2 348..372 CDD:290200 11/23 (48%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.