DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZSCAN25

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001337908.1 Gene:ZSCAN25 / 221785 HGNCID:21961 Length:544 Species:Homo sapiens


Alignment Length:510 Identity:113/510 - (22%)
Similarity:182/510 - (35%) Gaps:148/510 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCRTCGQEAEHAKSLFDKEARDVLSNILKLTGF----------WLRNQPGVPTRICLSCLLDLND 58
            |||...:...|.|        :.:..:|.|..|          |:|.......:...:.:.||. 
Human    66 LCRRWLRPELHTK--------EQILELLVLEQFLTILPREFYAWIREHGPESGKALAAMVEDLT- 121

  Fly    59 AIAFRERCIRTNSSWFEKQGKQED-------------------------------------SDTE 86
                 ||.:...:....:||:||:                                     ::.:
Human   122 -----ERALEAKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEEQ 181

  Fly    87 TAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGV---------PLKTVETPIYPLVVPE 142
            .:::.|:.....:...:|:..|.|....:.|:..:...|.         |.|.:     .|..||
Human   182 LSQDPGDETRAFQEQALPVLQAGPGLPAVNPRDQEMAAGFFTAGSQGLGPFKDM-----ALAFPE 241

  Fly   143 -----IPPADL------VDPLRCE-DPIQVKSE-----PQLSSDYPVESMNHEE----------- 179
                 :.||.:      |:|..|. .|.....|     ||......:.::..|.           
Human   242 EEWRHVTPAQIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVALTSERFGEASLQGPGL 306

  Fly   180 ----------PASEMPQVMKEEPRTLQVIGEVQKNRR--KPRSKGCLEECP--GKDMAKIENIDS 230
                      ||...|.:...:...:.:..||:.:..  ||      .:||  ||..::..|: .
Human   307 GRVCEQEPGGPAGSAPGLPPPQHGAIPLPDEVKTHSSFWKP------FQCPECGKGFSRSSNL-V 364

  Fly   231 TTNKTKEEKYATRNKWGAAK-------RAYALEH-------RLYFCDQCGKTFSEKGNFNVHLRR 281
            ...:|.|||     .:|..:       |.|.::|       |.|.|.:|.||||::.:..||.|.
Human   365 RHQRTHEEK-----SYGCVECGKGFTLREYLMKHQRTHLGKRPYVCSECWKTFSQRHHLEVHQRS 424

  Fly   282 HKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHR 346
            |.|.|.::|.:|.:....:..|.:| |..|.||.||.|: |||.|........|.|.|..   .:
Human   425 HTGEKPYKCGDCWKSFSRRQHLQVH-RRTHTGEKPYTCE-CGKSFSRNANLAVHRRAHTG---EK 484

  Fly   347 PHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHR 401
            |:.|..|.|.|.....|..|..:||||:|:||..|...||:|:.|..|.|::|.:
Human   485 PYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQ 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 14/81 (17%)
zf-C2H2 260..282 CDD:278523 10/21 (48%)
C2H2 Zn finger 262..282 CDD:275368 9/19 (47%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
COG5048 <298..>383 CDD:227381 31/84 (37%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 11/27 (41%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
ZSCAN25NP_001337908.1 SCAN 38..136 CDD:322011 14/83 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..189 1/31 (3%)
KRAB_A-box 231..>259 CDD:143639 7/32 (22%)
COG5048 <324..532 CDD:227381 68/224 (30%)
C2H2 Zn finger 350..370 CDD:275368 5/20 (25%)
C2H2 Zn finger 377..397 CDD:275368 3/19 (16%)
C2H2 Zn finger 405..425 CDD:275368 9/19 (47%)
C2H2 Zn finger 433..453 CDD:275368 5/20 (25%)
C2H2 Zn finger 461..480 CDD:275368 7/19 (37%)
C2H2 Zn finger 488..508 CDD:275368 6/19 (32%)
C2H2 Zn finger 516..535 CDD:275368 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.