DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF584

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_775819.1 Gene:ZNF584 / 201514 HGNCID:27318 Length:421 Species:Homo sapiens


Alignment Length:357 Identity:91/357 - (25%)
Similarity:132/357 - (36%) Gaps:100/357 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKS 162
            |.|||.|:|.|:       .:|...:||:                         .|.||.   ::
Human    79 SWVDVTPVSRAE-------ARRGFGLDGL-------------------------CRVEDE---RA 108

  Fly   163 EPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIGEVQKNRRKPRSKGC-----------LEE 216
            .|:....|.|  :.|::..||      .:||.     ..:.....|....|           |.:
Human   109 HPEHLKSYRV--IQHQDTHSE------GKPRR-----HTEHGAAFPPGSSCGQQQEVHVAEKLFK 160

  Fly   217 CP--GKDMAK-IENIDSTTNKTKEEKYATRNKWGAAKRAYALEHR-------LYFCDQCGKTFSE 271
            |.  ||...| ...:|.....::|..:.......|.|::..:..|       .:.|::|||.||.
Human   161 CSDCGKVFLKAFALLDHLITHSEERPFRCPTGRSAFKKSAHINPRKIHTGETAHVCNECGKAFSY 225

  Fly   272 KGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHE 336
            ......|.:.|.|.|.|:|.:|.:....:..|.||.|| |.||.||.|..|||.|......:.|.
Human   226 PSKLRKHQKVHTGIKPFKCSDCGKTFNRKDALVLHQRI-HTGERPYECSKCGKTFSVLSTLIRHR 289

  Fly   337 RNH-KESP---------------------VH---RPHVCSTCQKAFKTSTALKDHIVVHTGEQPF 376
            :.| .|.|                     ||   ||..|..|.|.:.|.:.|..|..|||||:|:
Human   290 KVHIGERPYECTECGKFFKYNNSFILHQRVHTGERPFECKQCGKGYVTRSGLYQHWKVHTGERPY 354

  Fly   377 HCELCQTFFNRRNALATHYKSKHHRLKVEEQS 408
            .|.||...|..|:     |:::|.:...||:|
Human   355 ECSLCGKTFTTRS-----YRNRHQQFHTEERS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 38/109 (35%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 9/31 (29%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
ZNF584NP_775819.1 KRAB 17..77 CDD:214630
KRAB 17..56 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..146 6/36 (17%)
C2H2 Zn finger 161..181 CDD:275368 5/19 (26%)
COG5048 <189..374 CDD:227381 58/190 (31%)
zf-C2H2 214..236 CDD:278523 7/21 (33%)
C2H2 Zn finger 216..236 CDD:275368 7/19 (37%)
zf-H2C2_2 229..253 CDD:290200 7/23 (30%)
C2H2 Zn finger 244..264 CDD:275368 7/20 (35%)
zf-H2C2_2 256..280 CDD:290200 14/24 (58%)
C2H2 Zn finger 272..292 CDD:275368 6/19 (32%)
zf-H2C2_2 285..309 CDD:290200 4/23 (17%)
C2H2 Zn finger 300..320 CDD:275368 0/19 (0%)
zf-H2C2_2 316..337 CDD:290200 7/20 (35%)
C2H2 Zn finger 328..348 CDD:275368 6/19 (32%)
C2H2 Zn finger 356..376 CDD:275368 7/24 (29%)
zf-H2C2_2 370..393 CDD:290200 4/12 (33%)
C2H2 Zn finger 384..404 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.