DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and blmp-1

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001251370.1 Gene:blmp-1 / 172917 WormBaseID:WBGene00003847 Length:817 Species:Caenorhabditis elegans


Alignment Length:164 Identity:54/164 - (32%)
Similarity:75/164 - (45%) Gaps:11/164 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 YFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQ--HLLNLHVRIKHRGELPYVCKYC 322
            |.|..|.|||.:..|..||:|.|.|.:.|:|:.|.: ||||  ||...|  :.|.||.|:.|..|
 Worm   508 YACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTK-EFTQLAHLQKHH--LVHTGERPHRCDIC 569

  Fly   323 GKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNR 387
            .|||.:......|.|.|..   .:|:.|..|...|.....|:.|..:|..|:|:.|..|...:..
 Worm   570 DKRFSSTSNLKTHLRLHNG---QKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYIS 631

  Fly   388 RNALATHYKSKHHRLKVEEQSKMPKMDATVQADG 421
            .:.|.||:|:...:   ||..|....|..:...|
 Worm   632 PSGLRTHWKTTTCK---EEDMKDSMRDDLMDIKG 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 10/21 (48%)
C2H2 Zn finger 262..282 CDD:275368 9/19 (47%)
C2H2 Zn finger 290..311 CDD:275368 9/22 (41%)
COG5048 <298..>383 CDD:227381 29/86 (34%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 5/19 (26%)
ZnF_U1 375..407 CDD:197732 8/31 (26%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
blmp-1NP_001251370.1 SET 119..247 CDD:214614
zf-C2H2 508..530 CDD:278523 10/21 (48%)
C2H2 Zn finger 510..530 CDD:275368 9/19 (47%)
zf-H2C2_2 522..547 CDD:290200 11/25 (44%)
C2H2 Zn finger 538..558 CDD:275368 9/22 (41%)
zf-H2C2_2 550..575 CDD:290200 12/26 (46%)
C2H2 Zn finger 566..586 CDD:275368 7/19 (37%)
zf-H2C2_2 578..603 CDD:290200 7/27 (26%)
C2H2 Zn finger 594..614 CDD:275368 5/19 (26%)
zf-H2C2_2 606..631 CDD:290200 7/24 (29%)
ARS2 <620..772 CDD:282772 11/46 (24%)
C2H2 Zn finger 622..641 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.