DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF383

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001332876.1 Gene:ZNF383 / 163087 HGNCID:18609 Length:475 Species:Homo sapiens


Alignment Length:169 Identity:58/169 - (34%)
Similarity:80/169 - (47%) Gaps:32/169 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 EHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRM-----EFTQHL------------- 302
            |.|.|.|.:|||.||:...|..|.|.|.|.|.::|:||.:.     ..|:||             
Human   166 EDRPYECKKCGKAFSQNSQFIQHQRIHIGEKSYECKECGKFFSCGSHVTRHLKIHTGEKPFECKE 230

  Fly   303 ----------LNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAF 357
                      |:.|.|| |.|:.||.||.|||.|..|...::|:|.|..   .:|:.|..|.|||
Human   231 CGKAFSCSSYLSQHQRI-HTGKKPYECKECGKAFSYCSNLIDHQRIHTG---EKPYECKVCGKAF 291

  Fly   358 KTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYK 396
            ..|:.|..|..:||||:|:.|:.|...|.:.:.|..|.:
Human   292 TKSSQLFQHARIHTGEKPYECKECGKAFTQSSKLVQHQR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 10/21 (48%)
C2H2 Zn finger 262..282 CDD:275368 9/19 (47%)
C2H2 Zn finger 290..311 CDD:275368 10/48 (21%)
COG5048 <298..>383 CDD:227381 37/107 (35%)
C2H2 Zn finger 319..339 CDD:275368 9/19 (47%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 6/22 (27%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
ZNF383NP_001332876.1 KRAB 6..66 CDD:214630
zf-C2H2 170..192 CDD:395048 10/21 (48%)
C2H2 Zn finger 172..192 CDD:275368 9/19 (47%)
zf-H2C2_2 187..209 CDD:404364 8/21 (38%)
C2H2 Zn finger 200..220 CDD:275368 6/19 (32%)
zf-H2C2_2 212..237 CDD:404364 3/24 (13%)
C2H2 Zn finger 228..248 CDD:275368 4/20 (20%)
COG5048 <231..475 CDD:227381 37/104 (36%)
C2H2 Zn finger 256..276 CDD:275368 9/19 (47%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
C2H2 Zn finger 312..332 CDD:275368 5/19 (26%)
C2H2 Zn finger 340..360 CDD:275368
C2H2 Zn finger 368..388 CDD:275368
C2H2 Zn finger 396..416 CDD:275368
C2H2 Zn finger 424..444 CDD:275368
C2H2 Zn finger 452..472 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.