DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF565

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001035939.1 Gene:ZNF565 / 147929 HGNCID:26726 Length:499 Species:Homo sapiens


Alignment Length:138 Identity:54/138 - (39%)
Similarity:73/138 - (52%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 YFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQH-LLNLHVRIKHRGELPYVCKYCG 323
            |.|..|||.|.......||.|.|.|.:.::|:||.: .|.|| .|.:|.|| |.||.||.||.||
Human   279 YVCKDCGKAFIRGSQLTVHRRIHTGARPYECKECGK-AFRQHSQLTVHQRI-HTGEKPYECKECG 341

  Fly   324 KRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRR 388
            |.|.:..:...|:|.|..   .:|:.|..|.|||:....|..|..||||::|:.|:.|...|:|.
Human   342 KGFIHSSEVTRHQRIHSG---EKPYECKECGKAFRQHAQLTRHQRVHTGDRPYECKDCGKAFSRS 403

  Fly   389 NALATHYK 396
            :.|..|.:
Human   404 SYLIQHQR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 10/21 (48%)
COG5048 <298..>383 CDD:227381 36/85 (42%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 7/22 (32%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
ZNF565NP_001035939.1 KRAB 6..66 CDD:214630
C2H2 Zn finger 169..189 CDD:275368
COG5048 193..498 CDD:227381 54/138 (39%)
C2H2 Zn finger 197..217 CDD:275368
C2H2 Zn finger 225..245 CDD:275368
C2H2 Zn finger 253..273 CDD:275368
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
C2H2 Zn finger 309..329 CDD:275368 10/21 (48%)
C2H2 Zn finger 337..357 CDD:275368 8/19 (42%)
C2H2 Zn finger 365..385 CDD:275368 7/19 (37%)
C2H2 Zn finger 393..413 CDD:275368 6/19 (32%)
C2H2 Zn finger 421..441 CDD:275368
C2H2 Zn finger 449..469 CDD:275368
C2H2 Zn finger 477..497 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.