DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF684

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_689586.3 Gene:ZNF684 / 127396 HGNCID:28418 Length:378 Species:Homo sapiens


Alignment Length:320 Identity:85/320 - (26%)
Similarity:124/320 - (38%) Gaps:82/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 DPLRCEDPIQVKSEPQLSSDYPV--ESMNHEEPASEMPQVMKEEPRTLQVIGEVQK--------- 203
            :|...|.....:|.|:  ||||:  |...|.|.....   :|....|...|..:::         
Human    65 EPWMVEGANPHESSPE--SDYPLVDEPGKHRESKDNF---LKSVLLTFNKILTMERIHHYNMSTS 124

  Fly   204 -NRRKPRSKGCLEEC--PGKDMAK------IEN-----------------IDSTTNKTKEEKY-- 240
             |..:.:|....|:|  |..|:.|      :||                 |....|.|:::.:  
Human   125 LNPMRKKSYKSFEKCLPPNLDLLKYNRSYTVENAYECSECGKAFKKKFHFIRHEKNHTRKKPFEC 189

  Fly   241 -------------ATRNKWGAAKRAY-------ALEHRL--------------YFCDQCGKTFSE 271
                         ||..|....:|.:       |..|:.              |.|.||||||:.
Human   190 NDCGKAYSRKAHLATHQKIHNGERPFVCNDCGKAFMHKAQLVVHQRLHTGEKPYECSQCGKTFTW 254

  Fly   272 KGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHE 336
            ..:||.|::.|...|.|:|:||.:.......|..|.|. |.||.||.|..|||.|.|....:.|:
Human   255 NSSFNQHVKSHTLEKSFECKECGKTFRYSSSLYKHSRF-HTGEKPYQCIICGKAFGNTSVLVTHQ 318

  Fly   337 RNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYK 396
            |.|..   .:|:.|..|.|||...:.|..|.:.||||:|:.|..|...|::::.|..|.|
Human   319 RIHTG---EKPYSCIECGKAFIKKSHLLRHQITHTGEKPYECNRCGKAFSQKSNLIVHQK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 11/21 (52%)
C2H2 Zn finger 262..282 CDD:275368 10/19 (53%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 32/84 (38%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 7/22 (32%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
ZNF684NP_689586.3 KRAB 8..68 CDD:214630 1/2 (50%)
KRAB 8..47 CDD:279668
C2H2 Zn finger 161..181 CDD:275368 1/19 (5%)
zf-H2C2_2 173..198 CDD:290200 3/24 (13%)
COG5048 <185..345 CDD:227381 47/163 (29%)
zf-C2H2 187..209 CDD:278523 3/21 (14%)
C2H2 Zn finger 189..209 CDD:275368 3/19 (16%)
zf-H2C2_2 201..224 CDD:290200 4/22 (18%)
C2H2 Zn finger 217..237 CDD:275368 2/19 (11%)
zf-H2C2_2 230..253 CDD:290200 7/22 (32%)
C2H2 Zn finger 245..265 CDD:275368 10/19 (53%)
C2H2 Zn finger 273..293 CDD:275368 6/20 (30%)
zf-H2C2_2 285..308 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 314..336 CDD:290200 7/24 (29%)
COG5048 325..>378 CDD:227381 19/51 (37%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 341..366 CDD:290200 10/24 (42%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.