DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF641

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_689533.2 Gene:ZNF641 / 121274 HGNCID:31834 Length:438 Species:Homo sapiens


Alignment Length:414 Identity:97/414 - (23%)
Similarity:155/414 - (37%) Gaps:102/414 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSW---FEKQGKQEDSDTETA-REGGNNRLE 97
            | |..||....:|  |.|: .:..:.:|:.  .::.|   ..::|...|.:...| ...|:..|.
Human    51 W-RTVPGPLEHLC--CDLE-EEPQSLQEKA--QSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLV 109

  Fly    98 SRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLVVPE------------IPPADLVD 150
            :..|| .:..:|.:.|.:.|.             :|..|...|.:            ||..|::.
Human   110 TIKDV-SLCFSQEEWRSLDPS-------------QTDFYGEYVMQENCGIVVSLRFPIPKLDMLS 160

  Fly   151 PLR------CEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIGE--VQKNRRK 207
            .|.      ..||..::....|...|..:...||   .:.|::..|.||.|..:.|  |..|   
Human   161 QLEGGEEQWVPDPQDLEERDILRVTYTGDGSEHE---GDTPELEAEPPRMLSSVSEDTVLWN--- 219

  Fly   208 PRSKGCLEECPGKDMAKIENIDSTTNKTK----------EEKYATRNKWGAAKRAYALEHRLYFC 262
                      |..|    |:.||..:.::          |:.::  |...:.:....|  |.:.|
Human   220 ----------PEHD----ESWDSMPSSSRGMLLGPPFLQEDSFS--NLLCSTEMDSLL--RPHTC 266

  Fly   263 DQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFD 327
            .||||.|....:...|.:.|.|.:.:.|.:|::....:|.|..|.: .|..:....|..|||.| 
Human   267 PQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKTFGRRHHLIRHQK-THLHDKTSRCSECGKNF- 329

  Fly   328 NCLKRL-NHERNHKES---------------------PVHRPHVCSTCQKAFKTSTALKDHIVVH 370
            .|...| :|:|.|.|.                     ||.:.|||:.|.|:|.....|..|.:.|
Human   330 RCNSHLASHQRVHAEGKSCKGQEVGESPGTRKRQRAPPVPKCHVCTECGKSFGRRHHLVRHWLTH 394

  Fly   371 TGEQPFHCELCQTFFNRRNALATH 394
            |||:||.|..|:..|.|::.|..|
Human   395 TGEKPFQCPRCEKSFGRKHHLDRH 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 9/41 (22%)
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
COG5048 <298..>383 CDD:227381 33/106 (31%)
C2H2 Zn finger 319..339 CDD:275368 9/20 (45%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 8/20 (40%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
ZNF641NP_689533.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 1/2 (50%)
KRAB 109..170 CDD:214630 12/74 (16%)
KRAB 109..149 CDD:279668 8/53 (15%)
Transactivation 171..265 23/117 (20%)
COG5048 227..>372 CDD:227381 34/150 (23%)
C2H2 Zn finger 266..286 CDD:275368 7/19 (37%)
zf-H2C2_2 278..303 CDD:290200 5/24 (21%)
C2H2 Zn finger 294..314 CDD:275368 5/20 (25%)
C2H2 Zn finger 322..342 CDD:275368 9/20 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 345..367 0/21 (0%)
COG5048 351..>430 CDD:227381 22/68 (32%)
zf-C2H2 372..394 CDD:278523 8/21 (38%)
C2H2 Zn finger 374..394 CDD:275368 6/19 (32%)
zf-H2C2_2 386..411 CDD:290200 11/24 (46%)
C2H2 Zn finger 402..422 CDD:275368 6/17 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..438 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.