DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZIM3

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_443114.1 Gene:ZIM3 / 114026 HGNCID:16366 Length:472 Species:Homo sapiens


Alignment Length:371 Identity:84/371 - (22%)
Similarity:147/371 - (39%) Gaps:82/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KQGKQEDSDTETAREGGNNRLESRVDV-----MPISIAQPQRRRI--------LPQRSKKVDGVP 127
            :|||:...:.|...  |:.|.|...|:     .|..:.:...|.:        ..|:..:.||  
Human    62 EQGKEPWLEEEEVL--GSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVECDG-- 122

  Fly   128 LKTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEE----------PAS 182
                ...|.||.:.::.                      |..:.|::.:|::          |:.
Human   123 ----SKKILPLGIDDVS----------------------SLQHYVQNNSHDDNGYRKLVGNNPSK 161

  Fly   183 EMPQVMKEEP--RTLQVIGEVQKNRRKPRSKGCLE--ECP--GKDMAKIENIDSTTNKTKEEK-Y 240
            .:.|.:|...  :.......:|.:.|:   ..|.:  ||.  |:...:...:|.......||: |
Human   162 FVGQQLKCNACRKLFSSKSRLQSHLRR---HACQKPFECHSCGRAFGEKWKLDKHQKTHAEERPY 223

  Fly   241 ATRNKWGAAKRAYAL--------EHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRME 297
            ...|...|.|:...|        :.:.|.|..|||.||.|.:...|.:.|...|.:||.||:: .
Human   224 KCENCGNAYKQKSNLFQHQKMHTKEKPYQCKTCGKAFSWKSSCINHEKIHNAKKSYQCNECEK-S 287

  Fly   298 FTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTA 362
            |.|:...:..:..|.|:.|:.|..|||.|......:.|:|.|..   .:|:.||.|:|||...:.
Human   288 FRQNSTLIQHKKVHTGQKPFQCTDCGKAFIYKSDLVKHQRIHTG---EKPYKCSICEKAFSQKSN 349

  Fly   363 LKDHIVVHTGEQPFHCELC-QTFFNRRNALATHYKSKHHRLKVEEQ 407
            :.||..:|||::.:.|:|| .||..::|.:      :|.::...|:
Human   350 VIDHEKIHTGKRAYECDLCGNTFIQKKNLI------QHKKIHTGEK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 84/371 (23%)
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
COG5048 <298..>383 CDD:227381 28/85 (33%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 7/32 (22%)
C2H2 Zn finger 378..396 CDD:275368 6/18 (33%)
ZIM3NP_443114.1 KRAB 8..68 CDD:214630 3/5 (60%)
C2H2 Zn finger 169..189 CDD:275368 2/22 (9%)
zf-C2H2_8 172..241 CDD:318181 14/71 (20%)
C2H2 Zn finger 197..217 CDD:275368 3/19 (16%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
zf-H2C2_2 237..261 CDD:316026 6/23 (26%)
C2H2 Zn finger 253..273 CDD:275368 8/19 (42%)
C2H2 Zn finger 281..301 CDD:275368 5/20 (25%)
COG5048 <304..465 CDD:227381 29/95 (31%)
C2H2 Zn finger 309..329 CDD:275368 7/19 (37%)
C2H2 Zn finger 337..357 CDD:275368 8/19 (42%)
C2H2 Zn finger 393..413 CDD:275368
C2H2 Zn finger 421..441 CDD:275368
C2H2 Zn finger 449..470 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.