DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF660-ZNF197

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001338661.1 Gene:ZNF660-ZNF197 / 110354863 -ID:- Length:1029 Species:Homo sapiens


Alignment Length:517 Identity:125/517 - (24%)
Similarity:185/517 - (35%) Gaps:159/517 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETA 88
            ::.||.:.:|...|||  |...|:..:..||.|...::.....|||   |.:........:....
Human    57 QEALSRLRELCRRWLR--PEARTKAQILELLVLEQFLSILPGEIRT---WVQLHHPGSGEEAVAL 116

  Fly    89 REGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYP--LVVPEI---PPADL 148
            .|.....|:.....:|:.:..       ....:||...|..|: .|:.|  .:..||   ||.||
Human   117 VEELQKDLDGPAIQVPVLVKD-------QDTLQKVVSAPGTTL-PPVLPGSHIAAEICPHPPTDL 173

  Fly   149 VDPLRCEDPIQVKSEPQLSSDYPVESMNHEE-PASEM---------PQ--VMKEE---------- 191
            | ....:||......|:.|      :::.|| |.:::         ||  ||.||          
Human   174 V-AFNLQDPQHDSPAPEAS------ALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEW 231

  Fly   192 ------PRTL------------------------QVIGEVQKNRRKPRSKGCL------------ 214
                  .|.|                        :|..:...::|....||..            
Human   232 ACLGPIQRALYWDVMLENYGNVTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLD 296

  Fly   215 --EECPGKDMAK------IENIDST----------TNKTKEEKYATRNKW---------GAA--- 249
              |||..:.:|.      .|..|:.          ..:|..||..  .||         |:|   
Human   297 FEEECEWQVLASQWGNETDERADTVKKVSLCERDKKKRTPPEKQG--QKWKELGDSLTFGSAISE 359

  Fly   250 ---------------------KRAYALEHRL-------YFCDQCGKTFSEKGNFNVHLRRHKGTK 286
                                 |.::.:.||.       :.|.:|||.|.::.:..:|||.|.|.|
Human   360 SLIGTEGKKFYKCDMCCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNHSGEK 424

  Fly   287 EFQCQECDRMEFTQ--HLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHV 349
            .::|.||.: .|:|  :||| |.|| |.||.||.||.|||.|......:.|.|.|..   .||:.
Human   425 PYKCNECGK-AFSQSAYLLN-HQRI-HTGEKPYKCKECGKGFYRHSGLIIHLRRHSG---ERPYK 483

  Fly   350 CSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYK--SKHHRLKVEEQSK 409
            |:.|.|.|..:..|.||..:|.||:|:.|..||..|..:.:|..|.:  |.....|.:|..|
Human   484 CNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKCDECGK 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 15/51 (29%)
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 11/22 (50%)
COG5048 <298..>383 CDD:227381 37/86 (43%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 9/33 (27%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
ZNF660-ZNF197NP_001338661.1 SCAN 38..150 CDD:128708 21/104 (20%)
KRAB 216..256 CDD:307490 6/39 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..290 4/27 (15%)
C2H2 Zn finger 372..392 CDD:275368 3/19 (16%)
zf-H2C2_2 384..409 CDD:316026 7/24 (29%)
C2H2 Zn finger 400..420 CDD:275368 8/19 (42%)
COG5048 424..853 CDD:227381 49/128 (38%)
C2H2 Zn finger 428..448 CDD:275368 11/22 (50%)
C2H2 Zn finger 456..476 CDD:275368 8/19 (42%)
C2H2 Zn finger 484..504 CDD:275368 7/19 (37%)
C2H2 Zn finger 512..532 CDD:275368 6/19 (32%)
C2H2 Zn finger 540..560 CDD:275368 2/6 (33%)
C2H2 Zn finger 568..588 CDD:275368
C2H2 Zn finger 596..616 CDD:275368
C2H2 Zn finger 624..644 CDD:275368
C2H2 Zn finger 652..672 CDD:275368
C2H2 Zn finger 680..700 CDD:275368
C2H2 Zn finger 708..728 CDD:275368
C2H2 Zn finger 736..756 CDD:275368
COG5048 760..>1026 CDD:227381
C2H2 Zn finger 764..784 CDD:275368
C2H2 Zn finger 792..812 CDD:275368
C2H2 Zn finger 820..840 CDD:275368
C2H2 Zn finger 848..868 CDD:275368
C2H2 Zn finger 876..896 CDD:275368
C2H2 Zn finger 904..924 CDD:275368
C2H2 Zn finger 932..952 CDD:275368
C2H2 Zn finger 960..980 CDD:275368
C2H2 Zn finger 988..1008 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.