DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF460

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_006626.3 Gene:ZNF460 / 10794 HGNCID:21628 Length:562 Species:Homo sapiens


Alignment Length:399 Identity:106/399 - (26%)
Similarity:155/399 - (38%) Gaps:96/399 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DAIAFRERCIR-TNSSWFEKQGKQEDSDTETAREG-------GNNRLESRVDVMPISIAQPQRRR 114
            :::.|.:..:. |...|.:....|.....|...|.       |::.....|:.:|..:|.|:...
Human    11 ESVTFEDVAVTFTQEEWGQLDVTQRALYVEVMLETCGLLVALGDSTKPETVEPIPSHLALPEEVS 75

  Fly   115 ILPQRSKKV------------DGVPLKTVETPIYPLVVPE--------------IPPADLVDPLR 153
            :..|.::.|            || |.:..|..:.|...|:              :..||.:    
Human    76 LQEQLAQGVPRYSYLGQAMDQDG-PSEMQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGI---- 135

  Fly   154 CEDPIQVKSEPQ-----LSSDYPV-ESMNHEEPASEMPQVMKEEPRTLQVIGEVQKNRRKPRSKG 212
            |...||.:..|:     ..|..|| :|:.||...|...:.|..|...|     ||..:..||.|.
Human   136 CSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFL-----VQHEQILPRVKP 195

  Fly   213 CLEECP--GKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRL-------YFCDQCGKT 268
              .:||  ||...|.:::                          |:|.:       |.|.:|||.
Human   196 --YDCPECGKAFGKSKHL--------------------------LQHHIIHTGEKPYKCLECGKD 232

  Fly   269 FSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRL 333
            |:.:.:...|.|.|.|.|.|.|.||.|.......|..|.|: |.||.|:||..|||.|......:
Human   233 FNRRSHLTRHQRTHNGDKPFVCSECGRTFNRGSHLTRHQRV-HSGEKPFVCNECGKAFTYRSNFV 296

  Fly   334 NHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSK 398
            .|.::|.|.   :|..||.|.|.|..||||..|.::||||:||.|..|...||.|    :|.| :
Human   297 LHNKSHNEK---KPFACSECGKGFYESTALIQHFIIHTGERPFKCLECGKAFNCR----SHLK-Q 353

  Fly   399 HHRLKVEEQ 407
            |.|:...|:
Human   354 HERIHTGEK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 3/18 (17%)
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 35/84 (42%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 10/19 (53%)
ZnF_U1 375..407 CDD:197732 11/31 (35%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
ZNF460NP_006626.3 KRAB 12..53 CDD:307490 6/40 (15%)
C2H2 Zn finger 198..218 CDD:275368 7/45 (16%)
COG5048 222..552 CDD:227381 59/150 (39%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
C2H2 Zn finger 254..274 CDD:275368 7/20 (35%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..330 CDD:275368 10/19 (53%)
C2H2 Zn finger 338..358 CDD:275368 9/24 (38%)
C2H2 Zn finger 366..386 CDD:275368
C2H2 Zn finger 394..414 CDD:275368
C2H2 Zn finger 422..442 CDD:275368
C2H2 Zn finger 450..470 CDD:275368
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 506..526 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.