DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZSCAN30

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001106205.1 Gene:ZSCAN30 / 100101467 HGNCID:33517 Length:494 Species:Homo sapiens


Alignment Length:456 Identity:103/456 - (22%)
Similarity:169/456 - (37%) Gaps:101/456 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETA 88
            |:.||.:.:|...|||  |.|.::..:..||.|...:|.....::   :|..:...:...:..|.
Human    63 REALSRLRELCCQWLR--PEVHSKEQILELLMLEQFLAILPEELQ---AWLREHRPENGEEAVTM 122

  Fly    89 REGGNNRLESRVDVMPISIAQPQR------RRILPQRSKKVDGVPLKTVETPIYPL--------- 138
            .|.....||           :|::      :.:..|.......:...::.:|:.||         
Human   123 LEELEKELE-----------EPRQQDTTHGQEMFWQEMTSTGALKSLSLNSPVQPLENQCKTETQ 176

  Fly   139 -----------------------VVPEIPPADLVDP--LRCEDPIQVKSEPQLSSDYPVESMNHE 178
                                   :|..:..|.::.|  |..|...|..:|..|......:.....
Human   177 ESQAFQERDGRMVAGKVLMAKQEIVECVASAAMISPGKLPGETHSQRIAEEALGGLDNSKKQKGN 241

  Fly   179 EPASEMPQVMKEEPR-TLQVIGEVQKNRRKPRSKGCLE--ECPGKDMAKIENIDSTTNKTKEEKY 240
            ...:::.|:..::.. :|...     |||.|.....||  |..|.......:|...:..|:|:.|
Human   242 AAGNKISQLPSQDRHFSLATF-----NRRIPTEHSVLESHESEGSFSMNSNDITQQSVDTREKLY 301

  Fly   241 ---------ATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRM 296
                     ...:|....:|.:..| |.|.|.:|||.||...:...|.|.|.|.|.::|.||.:.
Human   302 ECFDCGKAFCQSSKLIRHQRIHTGE-RPYACKECGKAFSLSSDLVRHQRIHSGEKPYECCECGKA 365

  Fly   297 EFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNH---------------------- 339
            ......|..|.|| |.||.||.|..|||.|......:.|::.|                      
Human   366 FRGSSELIRHRRI-HTGEKPYECGECGKAFSRSSALIQHKKIHTGDKSYECIACGKAFGRSSILI 429

  Fly   340 KESPVH---RPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHR 401
            :...:|   :|:.|:.|.|:|..|:||..|..:||||:|:.|..|:..|..|:.|..|.:: |.|
Human   430 EHQRIHTGEKPYECNECGKSFNQSSALTQHQRIHTGEKPYECSECRKTFRHRSGLMQHQRT-HTR 493

  Fly   402 L 402
            :
Human   494 V 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 14/51 (27%)
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 33/109 (30%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 9/28 (32%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
ZSCAN30NP_001106205.1 SCAN 44..154 CDD:128708 20/106 (19%)
SCAN 44..122 CDD:280241 14/63 (22%)
COG5048 281..>360 CDD:227381 20/79 (25%)
zf-C2H2 301..323 CDD:278523 3/21 (14%)
C2H2 Zn finger 303..323 CDD:275368 2/19 (11%)
zf-H2C2_2 316..339 CDD:290200 8/23 (35%)
COG5048 <328..479 CDD:227381 48/151 (32%)
C2H2 Zn finger 331..351 CDD:275368 8/19 (42%)
zf-H2C2_2 343..366 CDD:290200 8/22 (36%)
C2H2 Zn finger 359..379 CDD:275368 7/20 (35%)
zf-H2C2_2 371..396 CDD:290200 14/25 (56%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 399..424 CDD:290200 2/24 (8%)
C2H2 Zn finger 415..435 CDD:275368 0/19 (0%)
zf-H2C2_2 428..452 CDD:290200 6/23 (26%)
C2H2 Zn finger 443..463 CDD:275368 8/19 (42%)
zf-H2C2_2 455..480 CDD:290200 11/24 (46%)
C2H2 Zn finger 471..491 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.