DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and bcl6ab

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_005171194.1 Gene:bcl6ab / 100001936 ZFINID:ZDB-GENE-030131-7523 Length:566 Species:Danio rerio


Alignment Length:391 Identity:94/391 - (24%)
Similarity:148/391 - (37%) Gaps:73/391 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 TNSSW--------------FEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQR 119
            ||..|              ..:.|....:.|..|.|.|:.. .:|..|: ...|:.:..|..|..
Zfish   200 TNPLWQIPKTTVIAHQQHSLPESGTSARTITNAAVEDGDKE-RNRPSVL-FRSARAEGNRKAPLL 262

  Fly   120 SKKVDGV----------PLKTVETPIYPLVV------PEIPPADLVDPLRCEDPIQVKSEPQLSS 168
            |.:|:.:          ||::...|..|...      |..||:.:           ..::.....
Zfish   263 SSEVENIEACHTGGPESPLRSDCQPNSPAESSGCSRRPASPPSSI-----------TYAKVHNWK 316

  Fly   169 DYPVESMNHEEPASEMPQVMKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKD---------MAK 224
            .|....:|..:.:|..|      |.|:.. ...|....|.:.....:||..|:         ..:
Zfish   317 KYKFIVLNSTDNSSLTP------PHTVSE-STNQNAEHKGQDNRSTDECIKKEEHGSSVHNTFTE 374

  Fly   225 IENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGN-FNVHLRRHKGTKEF 288
            ..::.||.:..:|..|....:..|.|..:..:.:.|.||:|...|..||| .:.|...|.|.|.:
Zfish   375 ESSMGSTNSAERERVYCNECESEAEKPQWLQDGKPYKCDRCQAMFHYKGNPLSSHKSVHTGEKPY 439

  Fly   289 QCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVH---RPHVC 350
            :|..|.........|..|.|| |.||.||.|:.|..||    .::.|.|.|  ..:|   :|:.|
Zfish   440 RCNVCGAQFNRPANLKTHSRI-HSGEKPYKCETCSSRF----VQVAHLRAH--VLIHTGEKPYPC 497

  Fly   351 STCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHRL---KVEEQSKMPK 412
            ..|...|:....||.|:.:||||:|:|||.|...|..::.|..|.:.||..:   ||:.....|:
Zfish   498 DICGTRFRHLQTLKSHLRIHTGEKPYHCENCDLRFRHKSQLRLHLRQKHGAITNTKVQYGRTRPE 562

  Fly   413 M 413
            :
Zfish   563 L 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 3/20 (15%)
zf-C2H2 260..282 CDD:278523 9/22 (41%)
C2H2 Zn finger 262..282 CDD:275368 8/20 (40%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 33/87 (38%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 12/34 (35%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
bcl6abXP_005171194.1 BTB 22..126 CDD:279045
BTB 33..128 CDD:197585
C2H2 Zn finger 412..433 CDD:275368 8/20 (40%)
zf-H2C2_2 426..450 CDD:290200 6/23 (26%)
C2H2 Zn finger 441..461 CDD:275368 6/20 (30%)
zf-H2C2_2 453..478 CDD:290200 13/29 (45%)
C2H2 Zn finger 469..489 CDD:275368 7/25 (28%)
zf-H2C2_2 481..506 CDD:290200 8/26 (31%)
C2H2 Zn finger 497..517 CDD:275368 6/19 (32%)
zf-H2C2_2 510..534 CDD:290200 13/23 (57%)
C2H2 Zn finger 525..543 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.