DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and AZF1

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_014756.3 Gene:AZF1 / 854280 SGDID:S000005639 Length:914 Species:Saccharomyces cerevisiae


Alignment Length:578 Identity:108/578 - (18%)
Similarity:186/578 - (32%) Gaps:155/578 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SDSKWVRQSNDNKDTMRSSRQVNKKLVKLFLAEADDSDATCTTSTALDTTTADSAFFDSDFEEES 72
            :||.....:|:|.:...::...|.        :.:|:.....|||.: ....|.:...:|....|
Yeast   358 NDSSNNNNNNNNNNNNENNNDNNN--------DNNDNSINSATSTNI-PNQEDHSLASTDTTSNS 413

  Fly    73 -TGLQECDPPPASKCRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGVKELPHHICST 136
             ..|:|.:           :.:.:|.:.:|.|.......|....||.|                 
Yeast   414 RKDLKEIE-----------QRLRKHLNDEDNYSSAISRPLDKNDVIEG----------------- 450

  Fly   137 CQETVNKSMEFRAKCQQVDKKLRQTTEKYNIQICDEEMESELENVLYEESAQQAKGVVGLEDFSS 201
             .|.:||.::.......:.||.::......::   .|| ...:..:.::::..|:| ..:.:||.
Yeast   451 -SEGLNKHIDESGMQPNIIKKRKKDDSTVYVK---NEM-PRTDPPMSKDNSTSAEG-AAMANFSG 509

  Fly   202 E--LLPDSEGVLDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFALEQNKSCNEIISIRKCKTKEE 264
            :  .:||...|.|      ||.....:...|:|.|                  ||..||....|:
Yeast   510 KEPPIPDISSVSD------DATNLIGATKVDQLML------------------IIQARKKGFTEK 550

  Fly   265 IGKVDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKC 329
            :.....|..::...:.              .||.|.:|....|:....:..|             
Yeast   551 VNTTQDGDLLFNQTMD--------------ILPPKSELVGGVEKPKGTQNTR------------- 588

  Fly   330 GHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANAS 394
                              ..|..|||.|.:.|.......:|||: |.|..||.|::|.:.|....
Yeast   589 ------------------AVKKHECPYCHRLFSQATHLEVHVRS-HIGYKPFVCDYCGKRFTQGG 634

  Fly   395 SRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKI--C 457
            :...||| :|              .|...:.|..|.|.::.|..|..|:..|...:||.||:  |
Yeast   635 NLRTHER-LH--------------TGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENC 684

  Fly   458 QMKFADPSAMKRHQALHDKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNL 522
            ...|.....||.||....|..:..        |.::|.:       |:|......:......|..
Yeast   685 NKTFTQLGNMKAHQNRFHKETLNA--------LTAKLAE-------MNPSENIPLEERQLLEYFA 734

  Fly   523 NKHKNTDLHRDNMQKAIKEEVNGLQQAFKDIDKEMDFESQTPMQPNAQEVRARTQDEK 580
            :.:||::       :.||....|:......|....:..:.|.:.||.....|...|.:
Yeast   735 SIYKNSN-------RGIKGRGKGVGTKKSTISSPENHPASTILNPNTNANNAIANDSE 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 12/73 (16%)
COG5048 <323..528 CDD:227381 45/206 (22%)
zf-C2H2 324..346 CDD:278523 0/21 (0%)
C2H2 Zn finger 326..346 CDD:275368 0/19 (0%)
C2H2 Zn finger 354..375 CDD:275368 7/20 (35%)
C2H2 Zn finger 383..401 CDD:275368 4/17 (24%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
C2H2 Zn finger 454..474 CDD:275368 8/21 (38%)
C2H2 Zn finger 481..501 CDD:275368 2/19 (11%)
C2H2 Zn finger 509..528 CDD:275368 2/18 (11%)
AZF1NP_014756.3 COG5048 342..768 CDD:227381 103/559 (18%)
C2H2 Zn finger 595..615 CDD:275368 7/20 (35%)
C2H2 Zn finger 623..643 CDD:275368 6/20 (30%)
C2H2 Zn finger 651..671 CDD:275368 6/19 (32%)
C2H2 Zn finger 679..702 CDD:275368 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.