DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and WIP3

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_172306.1 Gene:WIP3 / 837349 AraportID:AT1G08290 Length:337 Species:Arabidopsis thaliana


Alignment Length:266 Identity:53/266 - (19%)
Similarity:84/266 - (31%) Gaps:87/266 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LEQNKSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEE 308
            :|.|...::|    |.:.|:::..:..|...|      :....|.....:....|||..|...|:
plant    82 MENNSQASDI----KEENKDDVVTLQIGFPKY------HRGSSEDGSDITFDHQKKPIKREIIED 136

  Fly   309 -----KNRRRRE-----------------------RIQAKPLNYVCDKCGHTFRQRSQLQMHLLR 345
                 |.||:.:                       :|...|:.:.|..|..||.:.:.:|||:..
plant   137 GVVMMKKRRKMKFDEEIIDSDVEVCGKRFWIPSPAQIHVGPMQFACSICSKTFNRYNNMQMHMWG 201

  Fly   346 HN--------------------RAKNFECPE-C--------PKKFYDLYTRNIHVRALHKGEHPF 381
            |.                    |...:.|.| |        .|...|..|...|.:..| |..||
plant   202 HGSEFRKGADSLKGTIQPAAILRLPCYCCAEGCKNNINHPRSKPLKDFRTLQTHYKRKH-GSKPF 265

  Fly   382 PCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHM-NF 445
            .|..|.::.|.......||::.                 ....||| |...:..|:.|..|: :|
plant   266 SCGKCGKALAVKGDWRTHEKNC-----------------GKLWYCT-CGSDFKHKRSLKDHIRSF 312

  Fly   446 HNGSRP 451
            .:|..|
plant   313 GSGHSP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 35/159 (22%)
zf-C2H2 324..346 CDD:278523 7/21 (33%)
C2H2 Zn finger 326..346 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..375 CDD:275368 7/29 (24%)
C2H2 Zn finger 383..401 CDD:275368 4/17 (24%)
C2H2 Zn finger 426..446 CDD:275368 6/20 (30%)
C2H2 Zn finger 454..474 CDD:275368
C2H2 Zn finger 481..501 CDD:275368
C2H2 Zn finger 509..528 CDD:275368
WIP3NP_172306.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.