Sequence 1: | NP_001303488.1 | Gene: | CG17803 / 42141 | FlyBaseID: | FBgn0038547 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_172306.1 | Gene: | WIP3 / 837349 | AraportID: | AT1G08290 | Length: | 337 | Species: | Arabidopsis thaliana |
Alignment Length: | 266 | Identity: | 53/266 - (19%) |
---|---|---|---|
Similarity: | 84/266 - (31%) | Gaps: | 87/266 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 LEQNKSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEE 308
Fly 309 -----KNRRRRE-----------------------RIQAKPLNYVCDKCGHTFRQRSQLQMHLLR 345
Fly 346 HN--------------------RAKNFECPE-C--------PKKFYDLYTRNIHVRALHKGEHPF 381
Fly 382 PCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHM-NF 445
Fly 446 HNGSRP 451 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17803 | NP_001303488.1 | zf-AD | 86..160 | CDD:214871 | |
COG5048 | <323..528 | CDD:227381 | 35/159 (22%) | ||
zf-C2H2 | 324..346 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 326..346 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 354..375 | CDD:275368 | 7/29 (24%) | ||
C2H2 Zn finger | 383..401 | CDD:275368 | 4/17 (24%) | ||
C2H2 Zn finger | 426..446 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 454..474 | CDD:275368 | |||
C2H2 Zn finger | 481..501 | CDD:275368 | |||
C2H2 Zn finger | 509..528 | CDD:275368 | |||
WIP3 | NP_172306.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 62 | 1.000 | Inparanoid score | I2531 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |