DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and ZNF398

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_011514741.1 Gene:ZNF398 / 57541 HGNCID:18373 Length:647 Species:Homo sapiens


Alignment Length:379 Identity:102/379 - (26%)
Similarity:141/379 - (37%) Gaps:64/379 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 EEMESELENVLY--EESAQQAKGVVGLEDFSSELLPD------SEGVLDEDDFPLDAEPTQFSLS 228
            |..||::....|  ||...:|:|:.     .|.|.|:      |.....:|.|...|..:|.|.|
Human   251 ESKESDVYKSTYADEELVIKAEGLA-----RSSLCPEVPVPFSSPPAAAKDAFSDVAFKSQQSTS 310

  Fly   229 -----EDELDLDRDTEKDFALEQNKSC-------NEIISIRKCKTKEEIGKVDHGAKVYKVVLGE 281
                 ....||...:|......|..|.       .::.|...|           |..:.:.:|..
Human   311 MTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHC-----------GKNLSQDMLLT 364

  Fly   282 YNSLKETA-PKYSLSLPK--KPQLRVSPEEKNRRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHL 343
            :.....|. |......||  .||..:|...::       .|......|..|..||...|:|..||
Human   365 HQCSHATEHPLPCAQCPKHFTPQADLSSTSQD-------HASETPPTCPHCARTFTHPSRLTYHL 422

  Fly   344 LRHNRAKN-FECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAG 407
            ..||..:. |.||:|||:|.|......|.|| |..|.||.|..|..||:...|...|:|.     
Human   423 RVHNSTERPFPCPDCPKRFADQARLTSHRRA-HASERPFRCAQCGRSFSLKISLLLHQRG----- 481

  Fly   408 NRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQA 472
                   .::|...|   |.||...:.....|:.|...|.|.||:.|..|...|.....:..|:.
Human   482 -------HAQERPFS---CPQCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRR 536

  Fly   473 LH-DKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKH 525
            || .:.|..|..|.|.|:.:..|.|||.:|||..|:.|..|...:|::..|..|
Human   537 LHTGERPFSCPHCGKSFIRKHHLMKHQRIHTGERPYPCSYCGRSFRYKQTLKDH 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 67/205 (33%)
zf-C2H2 324..346 CDD:278523 8/21 (38%)
C2H2 Zn finger 326..346 CDD:275368 8/19 (42%)
C2H2 Zn finger 354..375 CDD:275368 10/20 (50%)
C2H2 Zn finger 383..401 CDD:275368 6/17 (35%)
C2H2 Zn finger 426..446 CDD:275368 5/19 (26%)
C2H2 Zn finger 454..474 CDD:275368 4/19 (21%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
C2H2 Zn finger 509..528 CDD:275368 5/17 (29%)
ZNF398XP_011514741.1 DUF3669 62..117 CDD:289202
KRAB 148..206 CDD:214630
KRAB_A-box 148..187 CDD:143639
COG5048 <349..593 CDD:227381 79/276 (29%)
C2H2 Zn finger 377..397 CDD:275368 5/26 (19%)
C2H2 Zn finger 405..425 CDD:275368 8/19 (42%)
C2H2 Zn finger 434..454 CDD:275368 10/20 (50%)
C2H2 Zn finger 462..482 CDD:275368 7/31 (23%)
C2H2 Zn finger 490..510 CDD:275368 5/19 (26%)
zf-H2C2_2 502..525 CDD:290200 8/22 (36%)
C2H2 Zn finger 518..538 CDD:275368 4/19 (21%)
zf-H2C2_2 530..555 CDD:290200 8/24 (33%)
zf-C2H2 544..566 CDD:278523 8/21 (38%)
C2H2 Zn finger 546..566 CDD:275368 8/19 (42%)
zf-H2C2_2 558..583 CDD:290200 10/24 (42%)
C2H2 Zn finger 574..592 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.