DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG1792

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:481 Identity:125/481 - (25%)
Similarity:192/481 - (39%) Gaps:129/481 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PASKCRTC--FRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGV-KELPHHICSTCQETVNK 143
            |...||||  |...|   ...:|::..|..:||.|:|:||:::..|. .|||..|||.|:..:..
  Fly     2 PNRNCRTCGLFIFCS---TPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQT 63

  Fly   144 SMEFRAKCQQVDKKLRQTTEKYNIQICDEEMESELENVLYEESAQQAKGVVGLEDFSSELLPDSE 208
            ::.||.:..:..|.|:::....|.::    :||....|  |:..|.|:.|..:|..  :|||: |
  Fly    64 AIAFRERVIRTQKTLQESPNLGNAEL----IESFAVGV--EKEIQYAEEVTEIEVI--DLLPE-E 119

  Fly   209 GVLDEDDFPLDA----EPTQFSLSEDELDLDRDTEKDFALEQNKSCNEIISIRKCKTKEEIGKVD 269
            .:|:|.:.|.:.    |..|..:...|..|.|.|                     ||.       
  Fly   120 HLLEETEEPYEICEQNEQPQVKVPAQEKKLRRST---------------------KTT------- 156

  Fly   270 HGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKCGHTFR 334
              ..|:..|....|| :.|..::|         |::.:|....:|||   :..:.:|::||..|.
  Fly   157 --PTVFTSVKFADNS-QATRTQWS---------RLTEDEVVALKRER---RKRDCICEQCGRHFT 206

  Fly   335 QRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRH 399
            ..|..::|||||...|:|.|.:|.::||.......| :.||.|...|.|.:|..:::|||.|.:|
  Fly   207 CPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRH-QELHAGNALFQCRYCEATYSNASGRIQH 270

  Fly   400 ERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADP 464
            ||..|       |.||.       ..|.:|.||:.....|..||..|.|.|.|.|..||:     
  Fly   271 ERMRH-------TNVKP-------FTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQV----- 316

  Fly   465 SAMKRHQALHDKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTD 529
                                  .|:.||.||.|                      |....|.:|.
  Fly   317 ----------------------SFVRRSHLTSH----------------------YRSKGHAHTS 337

  Fly   530 LHRDNMQKAIKEEV---NGLQQAFKD 552
            ..:..:...::.:|   ||:|...||
  Fly   338 SAQAALDNPVELDVKASNGMQTGAKD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 26/76 (34%)
COG5048 <323..528 CDD:227381 56/204 (27%)
zf-C2H2 324..346 CDD:278523 8/21 (38%)
C2H2 Zn finger 326..346 CDD:275368 8/19 (42%)
C2H2 Zn finger 354..375 CDD:275368 5/20 (25%)
C2H2 Zn finger 383..401 CDD:275368 7/17 (41%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
C2H2 Zn finger 454..474 CDD:275368 3/19 (16%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..528 CDD:275368 2/18 (11%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 26/76 (34%)
C2H2 Zn finger 198..218 CDD:275368 8/19 (42%)
C2H2 Zn finger 226..243 CDD:275368 5/17 (29%)
C2H2 Zn finger 254..275 CDD:275368 9/20 (45%)
zf-C2H2 281..303 CDD:278523 7/21 (33%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 296..320 CDD:290200 11/50 (22%)
C2H2 Zn finger 311..329 CDD:275368 9/66 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.