DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and trem

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster


Alignment Length:521 Identity:111/521 - (21%)
Similarity:187/521 - (35%) Gaps:143/521 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CRTCFRIISRHED-AQDLY-DRVNIALLHHIKVITGVWIQQGVKELPHHICSTCQETVNKSMEFR 148
            ||.|....|..|: ..|:: :..:..|...:.:..|:.:... ...|..:||.|...:....:||
  Fly    12 CRVCLNNPSEGEELLHDIFSETASTRLDQMLHICAGIPVSLD-DNFPDKMCSKCVRCLRLCYKFR 75

  Fly   149 AKCQQVDKKLRQTTEKYNIQICDEEMES----------------ELENVL--YEESAQQAKG--- 192
            ..||:        :.::.:.:.|.|..:                .:|:||  :|:.|.|..|   
  Fly    76 LTCQR--------SHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDYASQLDGGMK 132

  Fly   193 VVGLEDFSSELL--------PDSEGVLDEDDFPLDAEPTQFSLSE-----DELD-LDRDTEKDFA 243
            |.|.||...:::        .|...:.|..| |....|.:...:|     :|.: |..:...:.|
  Fly   133 VEGEEDQQHQVITYVVEDGDTDDTNMFDVHD-PTQPVPNEIEEAETYAEYEEYELLTNENSPEIA 196

  Fly   244 LEQNKSCNEIISIRKCKTKEEIGK--VDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSP 306
            .|:..:..::.:  :...:|||.:  :|...        :|:.......|...| .:||......
  Fly   197 QEKGSTGTDVAT--EEPPEEEIAEDILDSDE--------DYDPTHAKPEKCDRS-GRKPVAYHKN 250

  Fly   307 EEKNRRRRERIQAKPLN----YVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTR 367
            ..|....::::..||.|    |:||.||:.:..:::|..|:                ||      
  Fly   251 SPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHM----------------KF------ 293

  Fly   368 NIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKS 432
                   |.|..|                                           |.|..|.:.
  Fly   294 -------HSGVKP-------------------------------------------HECEICGRG 308

  Fly   433 YTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALHDK-FPIRCDICLKGFLLRSQLTK 496
            :...:.||.|||.|.|:||::|..|...|||.|...:|..:|.| .|..||:|.:.|.....|..
  Fly   309 FVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKF 373

  Fly   497 HQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHR-----DNMQKAIKEEVNGLQQAF-KDIDK 555
            |:.:|||..||.|::|...:...|.|..|:.|...|     |..:....|:|.|....| .::.|
  Fly   374 HKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEESTKAEDVKGETPEFLNELPK 438

  Fly   556 E 556
            |
  Fly   439 E 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 16/75 (21%)
COG5048 <323..528 CDD:227381 51/209 (24%)
zf-C2H2 324..346 CDD:278523 7/21 (33%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 2/20 (10%)
C2H2 Zn finger 383..401 CDD:275368 0/17 (0%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
C2H2 Zn finger 454..474 CDD:275368 7/19 (37%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..528 CDD:275368 5/18 (28%)
tremNP_650861.1 zf-AD 11..87 CDD:214871 16/83 (19%)
COG5048 <264..411 CDD:227381 55/218 (25%)
C2H2 Zn finger 274..294 CDD:275368 8/48 (17%)
zf-H2C2_2 287..311 CDD:290200 10/95 (11%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
zf-H2C2_2 345..367 CDD:290200 8/21 (38%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..394 CDD:290200 9/23 (39%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.