DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG14711

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:466 Identity:116/466 - (24%)
Similarity:178/466 - (38%) Gaps:116/466 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PPASKCRTCFRIISRHEDAQDLYD------RVNIALLHHIKVITGVWIQQGVKELPHHICSTCQE 139
            |....||.|.......|....|:|      |..:..:..:..|..|.:|    .:|..:|.:|.|
  Fly     2 PEYMLCRICLTEDINSEAMAPLFDDNDAQCRELVRKIEEVGSIKLVPLQ----NIPSMLCYSCVE 62

  Fly   140 TVNKSMEFRAKCQQVDKKLRQTTEKYNIQICDEEMESE---------LENV--LYEESAQQAKGV 193
            .:..:.:||..||:.::       .:...:...||:||         .:|:  :||.:.....||
  Fly    63 RLTSAHKFRELCQESER-------TFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDGV 120

  Fly   194 ---VGLEDFSSELLPDSEGVLDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFALEQNKSCNEIIS 255
               :|:|:...|.|.|..|   |.....:.......|.||:|.:...|:.|:  :..:.|.: ..
  Fly   121 EDDIGMENIMEEPLEDGVG---ETSQAYETSTVVDDLDEDDLLVPNSTDSDY--QPIERCRK-AK 179

  Fly   256 IRKCK-TKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQA 319
            :||.: ||...|: ..||.     .|...|..|..|      |.:...:.|||           .
  Fly   180 VRKTRMTKRGRGR-PRGAS-----SGHPRSFSEERP------PVQASFKSSPE-----------V 221

  Fly   320 KPLNYVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCN 384
            ...|.:|:.||:.:.:|:.|.:|:.||...|.|:|..|.|.|......|.|:| :|.||.||.|.
  Fly   222 SSTNIMCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIR-VHTGEKPFLCK 285

  Fly   385 HCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGS 449
            :||.|||:.||..||||.                                           |...
  Fly   286 YCNRSFADRSSNIRHERT-------------------------------------------HTNE 307

  Fly   450 RPFQCKICQMKFADPSAMKRHQALH-DKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICD 513
            |||.|..|...|:..:.:|.|...| .:.|..|.:|.|.|..:.||    |.|.|...|:..:  
  Fly   308 RPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQL----DQHLGTMTHQQTV-- 366

  Fly   514 VHYRH----RY 520
            :|:::    ||
  Fly   367 IHHKNERTGRY 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 18/79 (23%)
COG5048 <323..528 CDD:227381 59/203 (29%)
zf-C2H2 324..346 CDD:278523 6/21 (29%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 7/20 (35%)
C2H2 Zn finger 383..401 CDD:275368 10/17 (59%)
C2H2 Zn finger 426..446 CDD:275368 0/19 (0%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..528 CDD:275368 3/16 (19%)
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 18/85 (21%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
zf-H2C2_2 240..264 CDD:290200 9/23 (39%)
COG5048 249..>362 CDD:227381 46/160 (29%)
C2H2 Zn finger 256..276 CDD:275368 7/20 (35%)
zf-H2C2_2 268..292 CDD:290200 12/24 (50%)
C2H2 Zn finger 284..304 CDD:275368 12/62 (19%)
zf-H2C2_2 299..321 CDD:290200 11/64 (17%)
C2H2 Zn finger 312..332 CDD:275368 5/19 (26%)
zf-H2C2_2 325..349 CDD:290200 8/23 (35%)
C2H2 Zn finger 340..362 CDD:275368 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.