DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG14710

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:472 Identity:110/472 - (23%)
Similarity:178/472 - (37%) Gaps:115/472 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PPASKCRTCFRIISRHEDAQDLY---DRVNIALLHHIKVITGVWIQQGVKELPHHICSTCQETVN 142
            |...:||.|   :...|::|.:.   |:....|...:::...:.::|. .:||...|::|.|.|.
  Fly     5 PVILQCRIC---LGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQS-PQLPEKACNSCCEFVQ 65

  Fly   143 KSMEFRAKC--QQV---------DKKLRQTT---------EKYNIQICDEEMESELENVLYEESA 187
            ....||..|  .||         .:.|.|.:         |..::::..|..|.|....:.|...
  Fly    66 MWFNFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGDE 130

  Fly   188 QQAKGVVGLEDFSSELLPDSEGV-----LDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFALEQN 247
            ||       ||.|.|:| |..|.     ::||:.|....|.|..:|..:..:|           :
  Fly   131 QQ-------EDQSQEVL-DFNGFIINESIEEDEEPNTESPEQILISHMDSYVD-----------D 176

  Fly   248 KSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAP---------KYSLSLPKKPQLR 303
            :...|:|. .|.:..||:...:   ..|:|..|:...|..:||         |.....|:||...
  Fly   177 QQMEELID-DKGELVEELSNAN---TFYEVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAE 237

  Fly   304 VSPEEKNRRRRER-IQAK---PLNYVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDL 364
            :..:.|:...:|| .|.|   ...::|..||:.|.::|....|::.|:..|..:|..|.|.|..:
  Fly   238 LKFKRKDINAKERGNQPKCKEEEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQM 302

  Fly   365 YTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQC 429
            .....|:|. |.|:.|:.|.:|:..|.:.|.|.||||                            
  Fly   303 GELRAHIRR-HTGDRPYKCMYCDRHFYDRSERVRHER---------------------------- 338

  Fly   430 TKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALHD-KFPIRCDICLKGFLLRSQ 493
                           .|..:||:.|:.|...|...:.:|.|...|. :....|.||.|.|.|..|
  Fly   339 ---------------VHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQ 388

  Fly   494 LTKHQDVHTGMHPHRCE 510
            |..|  :.|..|.::.|
  Fly   389 LKAH--LQTLTHRNKME 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 20/87 (23%)
COG5048 <323..528 CDD:227381 47/189 (25%)
zf-C2H2 324..346 CDD:278523 6/21 (29%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 6/20 (30%)
C2H2 Zn finger 383..401 CDD:275368 7/17 (41%)
C2H2 Zn finger 426..446 CDD:275368 0/19 (0%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 9/19 (47%)
C2H2 Zn finger 509..528 CDD:275368 1/2 (50%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 19/77 (25%)
COG5048 <261..395 CDD:227381 44/179 (25%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 6/22 (27%)
C2H2 Zn finger 292..312 CDD:275368 6/20 (30%)
zf-H2C2_2 304..327 CDD:290200 7/23 (30%)
C2H2 Zn finger 320..340 CDD:275368 9/62 (15%)
zf-H2C2_2 335..357 CDD:290200 10/64 (16%)
C2H2 Zn finger 348..368 CDD:275368 5/19 (26%)
C2H2 Zn finger 376..395 CDD:275368 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.