DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and M1BP

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:511 Identity:112/511 - (21%)
Similarity:202/511 - (39%) Gaps:139/511 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SKCRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQ-GVKELPHHICSTCQETVNKSMEF 147
            |.||.|.:..| ::.:..|::|.|..::.:|:.:||:.::. |.  ||..||..|...:..:::.
  Fly    11 STCRVCAKYAS-NKRSPKLFERSNTKMIDNIEALTGLRLENYGC--LPDQICECCSMELASAVKL 72

  Fly   148 RAKCQQVDKKL--------RQTTEKYN---------IQIC----DEEMESELENVLYEESAQQAK 191
            |.:|....::|        ||....:.         :|..    |:|:.:..:.::.||..::  
  Fly    73 RERCIAAQRELLLGLTEEQRQGISAFYRAAVMGEDIVQTVKTPDDDEVYATYQEIVLEEPKEE-- 135

  Fly   192 GVVGLED----FSSELLPDSEGVLDEDDFPLDAEPTQFS--LSEDE-----LDLDRDTEKDFALE 245
                ::|    :.:.....:||...|||.....|...:.  ::|||     |:||.|||      
  Fly   136 ----IDDTKVEYDNTYYEVAEGHAGEDDAASLIEEADYDSIMAEDEEQQQTLELDEDTE------ 190

  Fly   246 QNKSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKN 310
              ....::.......:.:|:..:|:      |:..||.  .|.......|||.||::|  .::..
  Fly   191 --LIVGDVNDAYVYDSDDEVAVLDN------VLDDEYE--HENIVVKKCSLPPKPKVR--SDDAR 243

  Fly   311 RRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALH 375
            ||....:      |:|::||:..:.|...::|..||...|.|.|..|..:|........|:|. |
  Fly   244 RRGTGGV------YICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRK-H 301

  Fly   376 KGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLV 440
            .||.||.|.:|...|.:.::|.:|||.                                      
  Fly   302 TGERPFACKYCGRCFTDYTTRVKHERT-------------------------------------- 328

  Fly   441 LHMNFHNGSRPFQCKICQMKFADPSAMKRHQALHDKFPIRCDICLKGFLLRSQLTKHQDVHTGMH 505
                 |...||:.|..|...|.                       .|::|::    |..:|:|..
  Fly   329 -----HTNERPYVCGTCGKAFT-----------------------TGYILKN----HMLIHSGER 361

  Fly   506 PHRCEICDVHYRHRYNLNKHKNTDLHRDNMQKAIKEEVNGLQQAFKDIDKEMDFES 561
            .:|||:||..:....:|:.|..:.:|:.:::||..::|  |:|..|...||.:.:|
  Fly   362 AYRCELCDKSFMLPTHLSTHFRSGVHKRHLEKAEMKQV--LEQEQKRELKEEEEDS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 19/82 (23%)
COG5048 <323..528 CDD:227381 45/204 (22%)
zf-C2H2 324..346 CDD:278523 6/21 (29%)
C2H2 Zn finger 326..346 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..375 CDD:275368 5/20 (25%)
C2H2 Zn finger 383..401 CDD:275368 5/17 (29%)
C2H2 Zn finger 426..446 CDD:275368 0/19 (0%)
C2H2 Zn finger 454..474 CDD:275368 3/19 (16%)
C2H2 Zn finger 481..501 CDD:275368 3/19 (16%)
C2H2 Zn finger 509..528 CDD:275368 6/18 (33%)
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 18/73 (25%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
COG5048 276..>331 CDD:227381 20/98 (20%)
C2H2 Zn finger 281..301 CDD:275368 5/20 (25%)
zf-H2C2_2 293..317 CDD:290200 9/24 (38%)
C2H2 Zn finger 309..329 CDD:275368 7/62 (11%)
zf-H2C2_2 324..346 CDD:290200 9/87 (10%)
C2H2 Zn finger 337..357 CDD:275368 6/46 (13%)
zf-H2C2_2 350..372 CDD:290200 9/25 (36%)
C2H2 Zn finger 365..383 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.