DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG8159

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster


Alignment Length:527 Identity:118/527 - (22%)
Similarity:194/527 - (36%) Gaps:162/527 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQ--QGVKELPHHICSTCQETVNKSMEFR 148
            ||.|.......:..: |::.....:|..|.::|||.:|  .|   ||..:|.|||..:..::.||
  Fly     6 CRVCASSTDNSKSLK-LFNSGACKVLQQINLLTGVLLQCEPG---LPDWMCETCQTDLKSAISFR 66

  Fly   149 AKCQQVDKKLRQTTEKYNIQICDEEMESELENVLYEESAQQAKGVVGLEDFSSELLPDSEGVLDE 213
            .:|.:..|            |.:|.:....|:.......:.|:               |:....|
  Fly    67 DRCLRSQK------------IFEESLVRNEEDTFRSSVRRSAR---------------SQRQRHE 104

  Fly   214 DDFP-LDAEPTQFSLSEDELDLDRDTEKDFALEQNKSCNEI---ISIRKCKTKEEIGKVDHGAKV 274
            |..| ..|.|.:..:..:  .|....|:|..::...||||.   ::|:...:..|    |.|.  
  Fly   105 DTAPKTPASPLEVMIKLE--SLSNGDEEDDGIDHLDSCNEADMELAIKAMSSSTE----DDGT-- 161

  Fly   275 YKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKCGHTFRQRSQL 339
                         |:| ..|...::..|:...:.:||.:    ...|: :.||:||:....:|..
  Fly   162 -------------TSP-VRLKRTRRRGLKKGGKGENRTK----VTLPV-FFCDQCGNNITGKSSF 207

  Fly   340 QMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVH 404
            ..||.:|:..:.|:|..||.:|........| :.:|.|:..|.|.:|:.::.|.|.|.|||    
  Fly   208 DRHLRKHSGIRPFQCELCPARFLSSGELKGH-QVMHTGDRKFQCRYCDRTYVNYSGRLRHE---- 267

  Fly   405 GAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKR 469
                  ||....:.     ..|.||.||:|:...|..||..|.|.|.|:|::|...||.|:.:|.
  Fly   268 ------RTHTNDRP-----FICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKT 321

  Fly   470 HQALHDKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHRDN 534
            |                                               .|.|.:||        |
  Fly   322 H-----------------------------------------------FRSNTHKH--------N 331

  Fly   535 MQKAIKEEVNGLQQA------------FKDIDKEMD-FESQTPMQPNAQEVRARTQDE------- 579
            ::|:: .:..|:|.:            .|:.:.|.| |..:.|: |..||     |||       
  Fly   332 LEKSM-ADAGGVQLSPSQSADQVKFVTEKEPEAEADAFTIEVPL-PAEQE-----QDESLGLAAL 389

  Fly   580 KTQTIEY 586
            :|.|:.|
  Fly   390 ETSTLMY 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 21/75 (28%)
COG5048 <323..528 CDD:227381 51/204 (25%)
zf-C2H2 324..346 CDD:278523 7/21 (33%)
C2H2 Zn finger 326..346 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..375 CDD:275368 5/20 (25%)
C2H2 Zn finger 383..401 CDD:275368 7/17 (41%)
C2H2 Zn finger 426..446 CDD:275368 9/19 (47%)
C2H2 Zn finger 454..474 CDD:275368 7/19 (37%)
C2H2 Zn finger 481..501 CDD:275368 0/19 (0%)
C2H2 Zn finger 509..528 CDD:275368 4/18 (22%)
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 22/87 (25%)
C2H2 Zn finger 194..214 CDD:275368 7/19 (37%)
COG5048 <197..322 CDD:227381 44/140 (31%)
zf-H2C2_2 206..231 CDD:290200 8/24 (33%)
C2H2 Zn finger 222..242 CDD:275368 5/20 (25%)
C2H2 Zn finger 250..270 CDD:275368 9/29 (31%)
zf-H2C2_2 265..287 CDD:290200 10/36 (28%)
C2H2 Zn finger 278..298 CDD:275368 9/19 (47%)
zf-H2C2_2 291..315 CDD:290200 10/23 (43%)
C2H2 Zn finger 306..328 CDD:275368 9/68 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.