DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and ouib

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:456 Identity:99/456 - (21%)
Similarity:157/456 - (34%) Gaps:156/456 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CRTCFR--IISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGVKELPHHICSTCQETVNKSMEFR 148
            ||.|.|  |.   |.:.:|:|.||...|.|:.:|:|:.:.. :.::|..:|..||..:..::.||
  Fly     6 CRVCGRQKIC---EKSLNLFDLVNRKYLKHLHMISGLRLVD-LDDVPGFMCLCCQAELRSALAFR 66

  Fly   149 AKCQQVDKKLRQTTEKYNIQICDEEMESELENVLYEESAQQAKGVVGLEDFSSELLPDSEGVLDE 213
            ..|.:...|.....:..:....|....||||:   |:.|        ..||..:    .||.|.|
  Fly    67 KLCIKTQTKWLTIEDDSSSGDEDTNDNSELES---EKCA--------FSDFGKK----KEGELVE 116

  Fly   214 DDFPLDAEPTQFSLSEDELD--LDRDTEKDFALEQNKSCNEIISIRKCKTKEEIGKVDHGAKVYK 276
            :.|       |..:.|:.:|  |:||.:   |..:....:|     ||...::|.||        
  Fly   117 ETF-------QVLIEEEPMDKTLNRDAK---AQLREDGIDE-----KCVPSQKIIKV-------- 158

  Fly   277 VVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKCGHTFRQRSQLQM 341
                                             :.:..::|      |:|:.||.....:...|.
  Fly   159 ---------------------------------STKLDDQI------YICELCGTHATSKPTFQR 184

  Fly   342 HLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGA 406
            |:.:                             |:||.||.|..|:..|.:|.....|.| ||  
  Fly   185 HMRK-----------------------------HRGERPFGCKDCDARFLSAGELRAHHR-VH-- 217

  Fly   407 GNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQ 471
                        .|.....|..|.|.|.|..|.::|...|...||:.|:.|..||.....:|.|.
  Fly   218 ------------TGEQPFACRFCEKRYVSYMGRLIHERTHTNDRPYVCEECGKKFTTAYVLKNHM 270

  Fly   472 ALHDKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHRDNMQ 536
            .                           :|||....||:|||..::.:.:|..|..:.:|..|::
  Fly   271 V---------------------------IHTGERNFRCDICDRSFQRKAHLVTHTRSMMHLQNVK 308

  Fly   537 K 537
            |
  Fly   309 K 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 22/75 (29%)
COG5048 <323..528 CDD:227381 46/204 (23%)
zf-C2H2 324..346 CDD:278523 6/21 (29%)
C2H2 Zn finger 326..346 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..375 CDD:275368 0/20 (0%)
C2H2 Zn finger 383..401 CDD:275368 5/17 (29%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..501 CDD:275368 0/19 (0%)
C2H2 Zn finger 509..528 CDD:275368 6/18 (33%)
ouibNP_649822.2 zf-AD 5..78 CDD:214871 22/75 (29%)
COG5048 <158..300 CDD:227381 48/259 (19%)
C2H2 Zn finger 169..189 CDD:275368 5/48 (10%)
C2H2 Zn finger 197..217 CDD:275368 6/20 (30%)
zf-H2C2_2 209..234 CDD:290200 9/39 (23%)
C2H2 Zn finger 225..245 CDD:275368 7/19 (37%)
zf-H2C2_2 241..262 CDD:290200 8/20 (40%)
C2H2 Zn finger 253..273 CDD:275368 6/46 (13%)
zf-H2C2_2 266..288 CDD:290200 10/48 (21%)
C2H2 Zn finger 281..299 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.