DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG7963

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster


Alignment Length:435 Identity:94/435 - (21%)
Similarity:159/435 - (36%) Gaps:96/435 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PPAS--KCRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGVKELPHHICSTCQETVNK 143
            ||:.  :||.|.:......|..::.:.:.:.|...::...|:.:.:...: |.::|..|...:..
  Fly     3 PPSGEFRCRVCLKQDELLVDIYEIVEEMQVDLCTLLETCGGIKVDRRDVQ-PMYLCQECTNELLI 66

  Fly   144 SMEFRAKCQQVDKKLRQTTEKYNIQICDEEMESELENVLYEESAQQAKGVVGLEDFSSELLPDSE 208
            :.:||..|.: .:|||....:.||... |.:.|| |.::.:.|           |:..:|    .
  Fly    67 AAKFRKICVE-SEKLRDMAPEINIDTA-EPLASE-EIIIIDPS-----------DYIEQL----S 113

  Fly   209 GVLDEDDFPLDAE-------PTQFSLSEDELDLDRDTEKDFALEQN-KSCNEIISIRKCKTKEEI 265
            .|.|.::.|:...       ...|.|||             .|.:: :..:..|:|..|:.:..|
  Fly   114 AVEDPENEPIGVSRWNCQHCGAGFQLSE-------------VLRRHIQEVHASITIIDCRERRRI 165

  Fly   266 GKVDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKCG 330
                      ...||.|.       .::.|..|.|:                    ..:.|.:||
  Fly   166 ----------FTKLGCYQ-------VHNCSYAKTPK--------------------RGHKCLECG 193

  Fly   331 HTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASS 395
            ...:..|.|..|:..|.....|.|.:|.|.|.......:|.|. ||......|.||...|..:|:
  Fly   194 KCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRR-HKQVLQHKCLHCGRGFVESSN 257

  Fly   396 RHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMK 460
            ..||              :.::......|.|....:|::....|.||:..:.|.||:.|:....:
  Fly   258 LRRH--------------IVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDKR 308

  Fly   461 FADPSAMKRHQALHDKFPI-RCDICLKGFLLRSQLTKHQDVH-TG 503
            ||....:|.|:.:|....: ||.:|.|.|....||.||...| ||
  Fly   309 FAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRHETG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 14/73 (19%)
COG5048 <323..528 CDD:227381 50/183 (27%)
zf-C2H2 324..346 CDD:278523 6/21 (29%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 6/20 (30%)
C2H2 Zn finger 383..401 CDD:275368 7/17 (41%)
C2H2 Zn finger 426..446 CDD:275368 5/19 (26%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
C2H2 Zn finger 509..528 CDD:275368
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 12/71 (17%)
C2H2 Zn finger 159..179 CDD:275368 5/36 (14%)
COG5048 184..>250 CDD:227381 19/86 (22%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
C2H2 Zn finger 217..237 CDD:275368 6/20 (30%)
C2H2 Zn finger 245..262 CDD:275368 7/30 (23%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
C2H2 Zn finger 302..322 CDD:275368 5/19 (26%)
zf-H2C2_2 315..339 CDD:290200 8/23 (35%)
C2H2 Zn finger 330..350 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ0F
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.