DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and Zif

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:501 Identity:102/501 - (20%)
Similarity:172/501 - (34%) Gaps:192/501 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CRTCF-------RIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGV--------KELPHHICS 135
            ||.|.       |:....|:.::..:.:.|.||             ||        :.:|..||.
  Fly    10 CRVCLAQSERLQRLDEIREEGEESPNEMLIQLL-------------GVSYSNLNDREHIPDGICK 61

  Fly   136 TCQETVNKSMEFRAKCQQVDKKLRQTTEKYNI----------------QICDEEMESELENVLYE 184
            :|:..:|.:.:||.|..:...::.:...:..:                |.|||||....|....|
  Fly    62 SCKVELNMAYQFREKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGE 126

  Fly   185 ESAQQAKGVVGLEDFSSELLPDSEGVLDEDDFPLDAEPTQFSLSEDELDLDRDT----EKDFALE 245
            |..|:.||              .|..|:.|             :.|:.:...||    |.::.:|
  Fly   127 EEHQEEKG--------------HEEYLEVD-------------TSDQQECIGDTIEYLEDNYTIE 164

  Fly   246 QNKSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKN 310
            .|....||:.              ...|.|:....:..:|:|.| |.||              |.
  Fly   165 MNSDQTEIVL--------------ESEKQYEETPSQQLALQEAA-KASL--------------KA 200

  Fly   311 RRRRERIQAKPLN------------YVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYD 363
            ||.|.|   :.||            |:||.||:.:.:|.::..|..||:....:.|..|..||  
  Fly   201 RRGRVR---RGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKF-- 260

  Fly   364 LYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQ 428
                                                         ::|.:::.            
  Fly   261 ---------------------------------------------QVREQLRK------------ 268

  Fly   429 CTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALHDKF-PIRCDICLKGFLLRS 492
                         ||..|.||:|::|..|..:|...|.:|.|:.:|... |..|.:|.|.|....
  Fly   269 -------------HMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAH 320

  Fly   493 QLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHRDNMQKA 538
            .||||:.:|:.:..:||:.|:..:|..:::.:|:.|.||::.:..|
  Fly   321 SLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQHEETKLHQNAVMLA 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 18/88 (20%)
COG5048 <323..528 CDD:227381 43/217 (20%)
zf-C2H2 324..346 CDD:278523 7/21 (33%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 4/20 (20%)
C2H2 Zn finger 383..401 CDD:275368 0/17 (0%)
C2H2 Zn finger 426..446 CDD:275368 2/19 (11%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
C2H2 Zn finger 509..528 CDD:275368 4/18 (22%)
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 18/89 (20%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
COG5048 <250..369 CDD:227381 37/189 (20%)
C2H2 Zn finger 253..273 CDD:275368 7/91 (8%)
zf-H2C2_2 266..288 CDD:290200 8/46 (17%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 8/23 (35%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..353 CDD:275368 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.