DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG14667

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:438 Identity:91/438 - (20%)
Similarity:151/438 - (34%) Gaps:133/438 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ASKCRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWI--QQGVKELPHHICSTCQETVNKSM 145
            |..||.|...|..|:..::::..:....|..:|:||||.:  .||   ||..:|..|...::.:.
  Fly     4 ADVCRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQG---LPEIVCERCFSELDLAT 65

  Fly   146 EFRAKCQQVDKKLRQTTEKYNIQICDEEMESELENVLYEESAQQAKGVVGLEDFSSELLPDSEGV 210
            :||.:|        ..::||.:.|..:..:....:|                :.|||  |..|.:
  Fly    66 KFRERC--------IFSQKYLLDIIKKTSDQSTVHV----------------ELSSE--PLDEQL 104

  Fly   211 LDEDDFPLDAEPTQF----SLSEDELDLDRDTEKDFALEQNKSCNEIISIRKCKTKEEIGKVDHG 271
            :|.|......:..|:    ...|:..||:     :..|:.:.|.                     
  Fly   105 IDADQLETHYDDDQYVCYQGTKEEHQDLE-----EIELDDDPSA--------------------- 143

  Fly   272 AKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKCGHTFRQR 336
                 .|:....:..|.|        ::..|:....|:..:||...      ::||:||..|...
  Fly   144 -----AVIAAAEAAAEAA--------QQEDLQEQEMERAAKRRSNF------FICDECGTLFHDA 189

  Fly   337 SQLQMHLLRHNRAKN----FECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRH 397
            .....||..|...::    |.|||||:.|........|...:|.....|.|..|:|:||:..::.
  Fly   190 FLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKL 254

  Fly   398 RHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFA 462
            ||::                                           .|...||:.|..|.|.|:
  Fly   255 RHDK-------------------------------------------AHKNERPYPCLECGMIFS 276

  Fly   463 DPSAMKRHQALHDK--FPIRCDICLKGFLLRSQLTKHQDVHTGMHPHR 508
            ..|.::.|.:.|.|  ...||:.|...|:.|..|.    .||...||:
  Fly   277 SVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLV----AHTKTAPHK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 20/75 (27%)
COG5048 <323..528 CDD:227381 46/192 (24%)
zf-C2H2 324..346 CDD:278523 7/21 (33%)
C2H2 Zn finger 326..346 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..375 CDD:275368 7/20 (35%)
C2H2 Zn finger 383..401 CDD:275368 7/17 (41%)
C2H2 Zn finger 426..446 CDD:275368 0/19 (0%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..501 CDD:275368 5/19 (26%)
C2H2 Zn finger 509..528 CDD:275368 91/438 (21%)
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 22/84 (26%)
C2H2 Zn finger 179..199 CDD:275368 7/19 (37%)
C2H2 Zn finger 211..232 CDD:275368 7/20 (35%)
C2H2 Zn finger 240..260 CDD:275368 7/62 (11%)
zf-C2H2_8 243..313 CDD:292531 23/116 (20%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 297..316 CDD:275368 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.