DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG8089

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster


Alignment Length:593 Identity:126/593 - (21%)
Similarity:205/593 - (34%) Gaps:176/593 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PAS---KCRTC--FRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGVKELPHHICSTCQETV 141
            |||   ||:.|  ||         :.|    :|.....:.|.|.       :....:|    |.|
  Fly    31 PASCHCKCKCCRGFR---------EKY----VAFNGEGETIFGT-------DFSSELC----EDV 71

  Fly   142 NKSMEFR------------------------AKCQQVDKKLRQTTEKYNIQICDEEMESELENVL 182
            .|.|.||                        |..|...:.:....|:.|.::..|::.:.|:.|.
  Fly    72 QKIMRFRSSDMLLLLRTAQLRDNFWTNEYFKADLQDDFRAIFDAFEEKNRKVQLEKLAAILDTVS 136

  Fly   183 --YEESAQQAKGVVGLEDFSSELLPDSEGV----LDEDDFPLDAEPTQFSLSEDELDLDRDTEKD 241
              |..|..|..|    ::....|.|....:    |..|.:..:..|.: .|.:.|     |.:|.
  Fly   137 SGYRRSVSQLAG----QEAHGALRPKIAALFLPGLRCDCYKCENLPWK-KLQDVE-----DHQKT 191

  Fly   242 FALEQNKSC----------NEIIS--IRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSL 294
            .....|..|          :.:.|  |||..:..|:    |..|.||.:|....|.:|...:.||
  Fly   192 HRYSDNFHCQICYRRFYLQHSLTSHIIRKSTSSREL----HENKRYKRLLENQKSQEEKELELSL 252

  Fly   295 S------LPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHLLRHNRAK--- 350
            :      :|....|:...:::::...::.:...|: .|..|...:......|:|:::|.|.:   
  Fly   253 NKVEDILVPVAEDLQSYFKDESKHPIQKRKTSSLS-KCPSCAQNYGFSFSHQLHMVKHRRERLYT 316

  Fly   351 --NFECPECPKKFYDLYTRNIHVRALHKGE-----------HPFPCNHCNESFANASSRHRHERD 402
              .|.|..|.:.|   .||    :.|.|.:           .||.|.||...|...|:...|...
  Fly   317 NFPFHCSFCNRSF---LTR----KFLRKHQQRVRTFSTLLYRPFKCPHCTWRFQLKSALDSHVLR 374

  Fly   403 VHGAGNRIRTRVKSKEEGSSRHYC--------TQCTKSYTSKKGLVLHMNFHNGSRPFQ------ 453
            :|                ..|..|        ..|..::|||:.......:.:..||.:      
  Fly   375 IH----------------ERRKPCLICKLPTSRLCCSAHTSKECNRAMQKYRDKMRPLREPPKGG 423

  Fly   454 --------CKICQMKFADPSAMKRH--QALHDKFPIRCDICLKGFLLRSQLTKHQD-VHTGMHPH 507
                    ||||..||.....::.|  :|..:|....|:||...|..:..:..|:. ||..:|..
  Fly   424 CRKQPTPVCKICNRKFTRKFFLEEHMNKAHLNKRNFTCEICGANFYSQGTMQTHRKAVHLLVHTV 488

  Fly   508 RCEICDVHYRHRYNLNKHKNTDLHRDNMQKAIKEEVNGLQQAFKDIDKEMDFESQTPMQPNAQEV 572
            :||:||:..:.:.|..:|..:..|:||:.|..|..           ||..|         :.:..
  Fly   489 QCEVCDLTIKSKGNYRRHCKSQSHKDNLVKFGKNN-----------DKTKD---------SNRRK 533

  Fly   573 RARTQDEK 580
            .|||.|||
  Fly   534 GARTTDEK 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 17/99 (17%)
COG5048 <323..528 CDD:227381 54/245 (22%)
zf-C2H2 324..346 CDD:278523 4/21 (19%)
C2H2 Zn finger 326..346 CDD:275368 4/19 (21%)
C2H2 Zn finger 354..375 CDD:275368 5/20 (25%)
C2H2 Zn finger 383..401 CDD:275368 6/17 (35%)
C2H2 Zn finger 426..446 CDD:275368 5/27 (19%)
C2H2 Zn finger 454..474 CDD:275368 8/21 (38%)
C2H2 Zn finger 481..501 CDD:275368 5/20 (25%)
C2H2 Zn finger 509..528 CDD:275368 6/18 (33%)
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 4/19 (21%)
C2H2 Zn finger 322..343 CDD:275368 7/27 (26%)
C2H2 Zn finger 355..376 CDD:275368 6/20 (30%)
C2H2 Zn finger 432..453 CDD:275368 7/20 (35%)
C2H2 Zn finger 461..486 CDD:275368 7/24 (29%)
C2H2 Zn finger 490..506 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.