DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and rgr

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster


Alignment Length:515 Identity:105/515 - (20%)
Similarity:173/515 - (33%) Gaps:143/515 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DSDFEEESTGLQECDPPPASKCRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGVKEL 129
            ::....|||..::.....|..|           ....||..|...:|...|....:|..|     
  Fly   432 EAKISNESTESEKSCETDADSC-----------GKSSLYHEVLSFILDAFKRQECLWNPQ----- 480

  Fly   130 PHHICSTC-------------QETVNKSMEFRAKCQQVD-------KKLRQTTEKYNIQI----C 170
             |:..:||             ||.:|..:.....|.::.       |:||...:...:.:    |
  Fly   481 -HYDYTTCCKTELFRDISVQLQEELNYELSGEECCNEIQKLRTRYRKELRMVIKHKGLYLPKLWC 544

  Fly   171 DEEMESELENVLYEE---SAQQAKGVVGLEDFSSELLPDSEGVLDEDDFPLDAEPTQFSLSE--- 229
            .:|||. |:.:|.|:   ...:..||||....:.        .:|......|....|....|   
  Fly   545 YDEMEF-LQPILQEQIFNKISKKIGVVGSNQKTK--------FIDASSIRFDNTEKQLQFVEIYH 600

  Fly   230 --------DELDLDRDTEKDFALEQNKSCNEI-ISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSL 285
                    |..|...:|.:..||.|  ..:|| .:.....|.|::.|.            .:|..
  Fly   601 NYSALWDVDHPDFRSNTYRSQALGQ--MLDEINTTFHTSYTAEQLEKT------------LFNLR 651

  Fly   286 KETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYV--------CDKCGHTFRQRSQLQMH 342
            ||      .|..|:   ::..|.::......:.||...::        ||.|....:...|.::|
  Fly   652 KE------FSAQKR---KILTESEDSSSIPLLHAKLAEFLDQNLGPFRCDICSDLVKTCDQYKVH 707

  Fly   343 LLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAG 407
            ...|:..:.|.|..|.|.|.......:|:|. |:.:.|:.|..|::.||.::.            
  Fly   708 RSAHDGTQPFICTLCGKGFQMPCNLTVHIRR-HRRDFPYSCEQCDKRFATSTE------------ 759

  Fly   408 NRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQA 472
                                           :.:|:..|.|.||:.|.:|...|...|....|:.
  Fly   760 -------------------------------VAIHLRTHTGERPYICDLCGKSFKTWSFFDIHRR 793

  Fly   473 LH-DKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLH 531
            .| ::....|.||.|||..:::.|.|.:.|..:..|.|.:|...:....||.||  |:||
  Fly   794 RHLNQSTFHCPICAKGFYEKNRFTDHMNSHWAIRKHLCTVCGKTFTTYGNLKKH--TELH 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 17/93 (18%)
COG5048 <323..528 CDD:227381 46/213 (22%)
zf-C2H2 324..346 CDD:278523 5/29 (17%)
C2H2 Zn finger 326..346 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..375 CDD:275368 6/20 (30%)
C2H2 Zn finger 383..401 CDD:275368 4/17 (24%)
C2H2 Zn finger 426..446 CDD:275368 1/19 (5%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
C2H2 Zn finger 509..528 CDD:275368 6/18 (33%)
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510
MADF_DNA_bdg 465..551 CDD:287510 18/92 (20%)
MADF_DNA_bdg 595..682 CDD:287510 20/109 (18%)
C2H2 Zn finger 691..711 CDD:275368 5/19 (26%)
C2H2 Zn finger 719..739 CDD:275368 6/20 (30%)
zf-H2C2_2 731..756 CDD:290200 7/25 (28%)
COG5048 742..>824 CDD:227381 24/124 (19%)
C2H2 Zn finger 747..767 CDD:275368 5/62 (8%)
zf-H2C2_2 763..784 CDD:290200 8/20 (40%)
C2H2 Zn finger 775..795 CDD:275368 5/19 (26%)
C2H2 Zn finger 803..818 CDD:275368 6/14 (43%)
C2H2 Zn finger 831..851 CDD:275368 7/21 (33%)
C2H2 Zn finger 859..877 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ0F
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.