DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and az2

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:564 Identity:115/564 - (20%)
Similarity:185/564 - (32%) Gaps:163/564 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 DPPPASKCRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGVKELPHHICSTCQETVNK 143
            |.||:|:.......:...|:..|..|..::.          |..:.|.:...|....|       
  Fly    94 DVPPSSENDESTSPVEEEEEEDDEVDSSSMT----------VDCELGTRNSTHFAPLT------- 141

  Fly   144 SMEFRAKCQQVDKKLRQTTEKYNIQIC-----DEE-MESELENVLYEESAQQAKGVVGLE----- 197
              :|.....:...::.|..|.|..|.|     ||. .:.|.....|||..:|.|..|.|.     
  Fly   142 --KFNPTFYRRSPRITQFIELYKQQTCLWDPADESYRDKEKRANAYEELLEQLKATVNLHLTAYK 204

  Fly   198 ----------DFSS---------------------ELLPDSEGVLDEDDFPLDAE---------- 221
                      .::|                     ..|.:...:.|.|...:|.:          
  Fly   205 LKKCITSLHAQYASISRQKKTQKLTKVPLYYHGKYSFLAERGSLEDADSDDVDGDGKIKLVFTEE 269

  Fly   222 ---PTQFSLSEDELDLDRDTEKDFALEQNKSCN------EIISIRKCKTKE-EIGKVDHGAKVYK 276
               .|||      :||.....:.:.......||      .:|.|....|.| .:|.|.|    |.
  Fly   270 NQLTTQF------IDLYSKFPQLYDPAHKHFCNLNVRKSSLIEITDLLTSEFSLGLVTH----YD 324

  Fly   277 VVLGEYNSLKETAPKYS-------------LSLPKKPQL-RVSPEEKNRRRRERIQAKPLNYVCD 327
            |    |:|::.....||             |||.:|..: |.:.....:..|::::       |:
  Fly   325 V----YDSIQSMRQWYSRRIKTLTDVQCVGLSLAEKQYIERCNSFMPTKSFRQKLK-------CE 378

  Fly   328 KCGHTFRQRSQLQMHLLRHNRAKN---FECPECPKKFYDLYTRNIHVRALHKGEH---PFPCNHC 386
            .|.|:|.....||.|..|.::..:   |.|..|...|    .|..|::...:..|   .|.|..|
  Fly   379 VCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNF----DRKCHLQQHSQRVHMDKSFVCEIC 439

  Fly   387 NESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRH-----YCTQCTKSYTSKKGLVLHMN-F 445
            :.|||              .||::....::.:|   :|     .|..|.|.:..|..:..|:. .
  Fly   440 SRSFA--------------FGNQLAIHKRTHDE---KHVAKPFVCEFCGKCFKQKIQMTTHVTAV 487

  Fly   446 HNGSRPFQCKICQMKFADPSAMKRHQALH----DKFPIRCDICLKGFLLRSQLTKHQDVHTGMHP 506
            |...|.|:|.:|...|.....:|.|...|    ||.   |::|.|.|...:.|.||:.:|. ...
  Fly   488 HTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKV---CEVCQKAFTNANALVKHRHIHK-EKT 548

  Fly   507 HRCEICDVHYRHRYNLNKHKNTDLHRDNMQKAIKEEVNGLQQAF 550
            .:|.:|...:..|.:|.      :|.....|.:|..::.....|
  Fly   549 LQCSLCTTRFSERVSLG------VHMRRTHKILKSSLSSSDALF 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 8/73 (11%)
COG5048 <323..528 CDD:227381 53/220 (24%)
zf-C2H2 324..346 CDD:278523 7/21 (33%)
C2H2 Zn finger 326..346 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..375 CDD:275368 5/20 (25%)
C2H2 Zn finger 383..401 CDD:275368 5/17 (29%)
C2H2 Zn finger 426..446 CDD:275368 5/20 (25%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..528 CDD:275368 4/18 (22%)
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 15/84 (18%)
GT1 276..>341 CDD:304916 18/78 (23%)
C2H2 Zn finger 377..398 CDD:275368 8/20 (40%)
C2H2 Zn finger 408..429 CDD:275368 5/24 (21%)
C2H2 Zn finger 436..456 CDD:275368 7/33 (21%)
C2H2 Zn finger 467..488 CDD:275368 5/20 (25%)
C2H2 Zn finger 496..516 CDD:275368 5/19 (26%)
C2H2 Zn finger 524..544 CDD:275368 7/19 (37%)
C2H2 Zn finger 551..572 CDD:275368 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.