DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG1529

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:552 Identity:122/552 - (22%)
Similarity:202/552 - (36%) Gaps:144/552 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ASKCRTCFRIISRHEDAQDLY--DRVNIALLHHIKVITGVWIQQGVKELPH----HICSTCQETV 141
            |..||.|.    ||...:|.:  |...||:|..:       :...:.:.||    .||:.|...|
  Fly     9 ARLCRICL----RHLRDRDTHCPDPRLIAILQKL-------LDIDILKQPHGFPTEICNLCHNAV 62

  Fly   142 NKSMEFRAKCQQVDKKL-------------RQTTEKYNIQICDEEMESELENVLYEESAQQAKG- 192
            ....|.|...::..:||             ::......::...||.|.|||    ||..:||.| 
  Fly    63 VYFDELRQVARESSQKLIGWQPVDIAVDRVKEEPPDEGLKENHEENEHELE----EEHEKQADGQ 123

  Fly   193 VVGLEDFSSELLPDSEGVLDEDDFPLDAE-PTQFSLSEDELDLDRDTEKDFALEQNKSCNEIISI 256
            .|.|    |:...|.:.:||:.:   |.| |.::..|:.:|.....:::...|    :|::    
  Fly   124 QVDL----SKKQEDQKKILDDRE---DEEYPDEYENSQQQLSQGTGSKRRAGL----ACDQ---- 173

  Fly   257 RKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYS---------LSLPKKPQLRVSPEEKNRR 312
              |           |.:|||:...|.: ::.....||         .|..:..||| |.......
  Fly   174 --C-----------GKQVYKLPYLEAH-IRSVHQGYSKPFLCRSCDKSFTRYEQLR-SHMRNAHP 223

  Fly   313 RRERIQAKPLNYVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKG 377
            :.|::|.:..:.:|:.|...:..::.|..||.||.:.|.                  ||      
  Fly   224 QLEQLQQELRDLICELCNRQYSTKNALGEHLKRHAQRKE------------------HV------ 264

  Fly   378 EHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLH 442
                 |.||..:....:....|          :||...:.|    |..|.||.:.:..|..:..|
  Fly   265 -----CEHCGVAKVTRTELLTH----------LRTHNPTWE----RFKCEQCPQLFRHKSAISRH 310

  Fly   443 MN-FHNGSRPFQCKICQMKFADPSAMKRHQALH----------DKFPIRCDICLKGFLLRSQLTK 496
            :. .|.|.|.|||..|:.||...::..||:.||          :::|..|..|.|..:.|..|..
  Fly   311 VRVVHEGQRRFQCGHCEKKFGTHASQVRHERLHTESTGSGEAAEEWPFACIHCQKPCVSRQTLEL 375

  Fly   497 HQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLH-RDNMQKAIKEEVNGLQQAFKDIDKEMDFE 560
            |...|.....||       .|..::....:....| ||..|.|.:.:.:.|::..|...:::..|
  Fly   376 HLRRHRARKTHR-------KRREHSRESQEQEQEHDRDQEQGAREAQQDQLRKGEKLRQRDLSRE 433

  Fly   561 S-------QTPMQPNAQEVRARTQDEKTQTIE 585
            |       ||..:||..:....:.|.:...:|
  Fly   434 SHRNEVTMQTSQRPNECQQGQESYDPEPDPLE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 20/92 (22%)
COG5048 <323..528 CDD:227381 47/215 (22%)
zf-C2H2 324..346 CDD:278523 5/21 (24%)
C2H2 Zn finger 326..346 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..375 CDD:275368 2/20 (10%)
C2H2 Zn finger 383..401 CDD:275368 4/17 (24%)
C2H2 Zn finger 426..446 CDD:275368 5/20 (25%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..528 CDD:275368 1/18 (6%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 18/78 (23%)
C2H2 Zn finger 171..192 CDD:275368 7/38 (18%)
zf-C2H2_2 201..>257 CDD:289522 12/56 (21%)
C2H2 Zn finger 201..222 CDD:275368 5/21 (24%)
C2H2 Zn finger 237..257 CDD:275368 5/19 (26%)
C2H2 Zn finger 265..285 CDD:275368 5/29 (17%)
zf-C2H2_8 268..349 CDD:292531 24/94 (26%)
C2H2 Zn finger 294..315 CDD:275368 5/20 (25%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I8018
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.