Sequence 1: | NP_001303488.1 | Gene: | CG17803 / 42141 | FlyBaseID: | FBgn0038547 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573329.2 | Gene: | CG7101 / 32875 | FlyBaseID: | FBgn0030963 | Length: | 352 | Species: | Drosophila melanogaster |
Alignment Length: | 290 | Identity: | 65/290 - (22%) |
---|---|---|---|
Similarity: | 93/290 - (32%) | Gaps: | 93/290 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 324 YVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNE 388
Fly 389 ------SFANASSRHRHERDVHGAGNRIRTRVKSKEEGSS------------------------- 422
Fly 423 -----------------------------------------RHY----------CTQCTKSYTSK 436
Fly 437 KGLVLHM-NFHNGSRPFQCKICQMKFADPSAMKRH-QALH-DKFPIRCDICLKGFLLRSQLTKHQ 498
Fly 499 DVHTGMHPH---RCEICDVHYRHRYNLNKH 525 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17803 | NP_001303488.1 | zf-AD | 86..160 | CDD:214871 | |
COG5048 | <323..528 | CDD:227381 | 65/290 (22%) | ||
zf-C2H2 | 324..346 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 326..346 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 354..375 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 383..401 | CDD:275368 | 4/23 (17%) | ||
C2H2 Zn finger | 426..446 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 454..474 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 481..501 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 509..528 | CDD:275368 | 5/17 (29%) | ||
CG7101 | NP_573329.2 | PHA00733 | <210..263 | CDD:177301 | 9/52 (17%) |
C2H2 Zn finger | 242..263 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 271..292 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 300..319 | CDD:275368 | 8/18 (44%) | ||
C2H2 Zn finger | 330..347 | CDD:275368 | 5/17 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45455513 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |