DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG7101

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster


Alignment Length:290 Identity:65/290 - (22%)
Similarity:93/290 - (32%) Gaps:93/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 YVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNE 388
            :||..|...|.:.::|:.|..|.:....|.|.:|.||:........||.:.|..:..|.|:.|.:
  Fly    62 FVCPHCLTLFGEEARLERHRERKHNDGQFLCLQCGKKYASATFLYRHVASWHGQQSLFYCDMCTD 126

  Fly   389 ------SFANASSRHRHERDVHGAGNRIRTRVKSKEEGSS------------------------- 422
                  :|:.......|..:||    |:||...:..:..|                         
  Fly   127 NCNDVKTFSGMLELQEHAEEVH----RLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWD 187

  Fly   423 -----------------------------------------RHY----------CTQCTKSYTSK 436
                                                     ||.          |..|.||:.|:
  Fly   188 DDLTFGWPTDLDKESCIVNAKPSVFVCPFCANGFPGSLSLVRHLEQVHERSALDCCYCGKSHGSR 252

  Fly   437 KGLVLHM-NFHNGSRPFQCKICQMKFADPSAMKRH-QALH-DKFPIRCDICLKGFLLRSQLTKHQ 498
            :.|..|: ..|...|...|.|||..||....:|:| .:|| |..|..|..|.|.|..|..||.|.
  Fly   253 EALRSHLQRVHILLRGHVCGICQADFATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHLTDHI 317

  Fly   499 DVHTGMHPH---RCEICDVHYRHRYNLNKH 525
            ....| |.|   .||.|...:....:|.:|
  Fly   318 KTDRG-HGHGTYTCEFCVRPFFRAIDLERH 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 65/290 (22%)
zf-C2H2 324..346 CDD:278523 6/21 (29%)
C2H2 Zn finger 326..346 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..375 CDD:275368 6/20 (30%)
C2H2 Zn finger 383..401 CDD:275368 4/23 (17%)
C2H2 Zn finger 426..446 CDD:275368 7/20 (35%)
C2H2 Zn finger 454..474 CDD:275368 8/20 (40%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
C2H2 Zn finger 509..528 CDD:275368 5/17 (29%)
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 9/52 (17%)
C2H2 Zn finger 242..263 CDD:275368 7/20 (35%)
C2H2 Zn finger 271..292 CDD:275368 8/20 (40%)
C2H2 Zn finger 300..319 CDD:275368 8/18 (44%)
C2H2 Zn finger 330..347 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.