DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and hang

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001138204.1 Gene:hang / 32613 FlyBaseID:FBgn0026575 Length:2223 Species:Drosophila melanogaster


Alignment Length:541 Identity:107/541 - (19%)
Similarity:194/541 - (35%) Gaps:151/541 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 ICSTCQETVN------KSMEFR--------AKCQQVD------KKLRQTTEKYNIQICDEEMES- 176
            :|..|.:..|      :.||.:        .||.:..      ..||:  ...|:...|:...| 
  Fly  1035 VCPICGQQYNNYNNVLRHMESKHPNKLPETYKCVRCGLGYPRISYLRE--HMINVHGVDKNRHSG 1097

  Fly   177 ELENVLYEESAQQAKG-----VVGLEDFSSELLPD--SEGVLDEDDFPLDAEPTQFSLSEDELDL 234
            ..|.::..::.:.|.|     ..|..|:..:.|..  :.|.||::    :.||...:   .::.|
  Fly  1098 GFEYIVNADAVKLADGSTPNVYTGRYDYVMKDLMSITNGGTLDDE----EEEPGSVA---KKMRL 1155

  Fly   235 DRDTEKDFAL----EQNKS---CNEIISIRKCKTKEEIGKVDHGAKVYKV--------------- 277
            | |:..:.:|    .|.|.   ||.:.|       ..||..:|....|..               
  Fly  1156 D-DSSNNSSLVGVASQQKECPICNAVFS-------NNIGLSNHMRSHYTASNAVNAALAAANRMT 1212

  Fly   278 --------------VLGEYNSLKETAPKYSLSLPKKPQL-RVSPEEKNRRRRERIQAKPLNY--- 324
                          .||...::.|:||....::|  |.: ..:|:|:...||...||....:   
  Fly  1213 PKSLTITATPATDSELGVGGTMSESAPATPANVP--PAMANQTPQEQAVFRRSLDQAADRRFRRM 1275

  Fly   325 VCDKCGHTFRQRSQLQMHLLRHNRAKN---FECPECPKKF-YD----LYTRNIHVRALHKGE--- 378
            .|..|...|..:...:.|:|..::.:|   .:|..|..:| |:    ::...:|.:|: |.|   
  Fly  1276 RCRICQRRFSSKKSYRYHMLTDHQVQNVQFIKCKLCNAEFAYEKGLKVHLFKVHGKAI-KDEMII 1339

  Fly   379 HPFPCNHCNESFANASSRHRHERDVH-----GAGNRIRTRVKSKEE------------------- 419
            ..|.|:.|:..:::.|...:|:|.||     .|.....|..|..::                   
  Fly  1340 KQFECDVCSIVYSSESELQQHKRSVHKLTSASASTSASTSSKIDDDSLMDDGKPTSSDLADLSTL 1404

  Fly   420 ---GSSR------HYCTQCTKSYTSKKGLVLHMNFHN--GSRPFQCKICQMKFADPSAM-----K 468
               ||:.      :.|..|..::.:.|.|.:|:|.|:  .|..:.||.|...::...::     |
  Fly  1405 AAGGSTASAPLYWYQCKYCPSNFNTNKKLAIHINSHDEFDSNDYSCKDCGNVYSGRKSLWVHRYK 1469

  Fly   469 RHQALHDKFPIRCDICLKGFLLRSQLTKHQD-------VHTGMHPHRCEICDVHYRHRYNLNKHK 526
            :|..:.:  |..|.:|.|.|..|.....|..       ..||.|..:......|:..:..:.:||
  Fly  1470 KHPQVPN--PAECSLCRKVFFDRQMHDNHTPTCNRKPITSTGAHQQQDGQLHSHHTAKRTIFRHK 1532

  Fly   527 ---NTDLHRDNMQKAIKEEVN 544
               :.|...|:.|:.::|..|
  Fly  1533 TGDDDDEEDDDEQQQLEERAN 1553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 8/46 (17%)
COG5048 <323..528 CDD:227381 53/268 (20%)
zf-C2H2 324..346 CDD:278523 5/24 (21%)
C2H2 Zn finger 326..346 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..375 CDD:275368 6/25 (24%)
C2H2 Zn finger 383..401 CDD:275368 4/17 (24%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
C2H2 Zn finger 454..474 CDD:275368 5/24 (21%)
C2H2 Zn finger 481..501 CDD:275368 6/26 (23%)
C2H2 Zn finger 509..528 CDD:275368 3/21 (14%)
hangNP_001138204.1 zf-AD 80..154 CDD:285071
C2H2 Zn finger 1036..1057 CDD:275368 5/20 (25%)
C2H2 Zn finger 1067..1088 CDD:275368 4/22 (18%)
C2H2 Zn finger 1279..1298 CDD:275371 4/18 (22%)
C2H2 Zn finger 1308..1325 CDD:275371 4/16 (25%)
C2H2 Zn finger 1420..1440 CDD:275368 6/19 (32%)
C2H2 Zn finger 1450..1468 CDD:275368 3/17 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.