DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG18262

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:403 Identity:90/403 - (22%)
Similarity:150/403 - (37%) Gaps:95/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 FSSELLPDSEGVLDEDDFPLDAEPTQF----------SLSEDELDLDRDTEKDFALEQNKSCNEI 253
            ||:....:...:|.:...|||..|..|          ||..:||:.|...:....::.|:..:|.
  Fly    24 FSAPASYEVSCLLCDQRLPLDGYPEHFRLKHFTNSSSSLCSNELESDPIAQDVVEVQGNEELHEE 88

  Fly   254 ISIRKC-------KTKEEIGKVDHGAKVYKVVLGEYNSLKETAPK-YSLSLP----KKPQLRVSP 306
            ::....       :.|||..|..|    |:......|:|.||... ..:.|.    ::.:...:.
  Fly    89 LAKEASPDLEEEEEEKEEGSKRQH----YQRAAAMKNTLVETREDLLDIELDWTGGEQSEHNETH 149

  Fly   307 EEKNRR-----RRERIQAKPLNYVCDKCGHTFRQRSQLQMH-LLRHNRA-----------KNFEC 354
            ||:...     .::....|.:.:.||:|...:..:..||.| .|:|:.|           :|.:.
  Fly   150 EEEEGESDDDDTKDSNDTKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKK 214

  Fly   355 PECPKKFYDLYTRNIHVRALHKGEHPFPCNH--CNESFANASSRHRHERDVHG------------ 405
            .:.|.|.|                   .||.  ||::|       |.|||:.|            
  Fly   215 RKGPPKVY-------------------KCNEEACNQTF-------RTERDLRGHRWKHTGIFCDI 253

  Fly   406 -------AGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFAD 463
                   :||.:|.|  .:..|...|.|.:|..::.::|.|..|...|.|..|..|::|.....|
  Fly   254 CGKPFTQSGNMMRHR--QRHSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRD 316

  Fly   464 PSAMKRHQALH-DKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKN 527
            ...:..|...| .:.|.:|::|.|.|.....|..|...||.:.|..|::|...::.:..|..||.
  Fly   317 RGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKL 381

  Fly   528 TDLHRDNMQKAIK 540
              ||.:..:.|.|
  Fly   382 --LHSEQRKYACK 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 57/238 (24%)
zf-C2H2 324..346 CDD:278523 7/22 (32%)
C2H2 Zn finger 326..346 CDD:275368 7/20 (35%)
C2H2 Zn finger 354..375 CDD:275368 3/20 (15%)
C2H2 Zn finger 383..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368 5/19 (26%)
C2H2 Zn finger 454..474 CDD:275368 4/19 (21%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..528 CDD:275368 5/18 (28%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 10/28 (36%)
C2H2 Zn finger 251..271 CDD:275368 4/21 (19%)
COG5048 <256..415 CDD:227381 38/141 (27%)
zf-H2C2_2 263..288 CDD:290200 7/26 (27%)
C2H2 Zn finger 279..327 CDD:275368 12/47 (26%)
zf-H2C2_2 320..342 CDD:290200 6/21 (29%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 5/21 (24%)
zf-C2H2 389..411 CDD:278523 2/4 (50%)
C2H2 Zn finger 391..411 CDD:275368 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ0F
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.