DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG2129

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster


Alignment Length:405 Identity:95/405 - (23%)
Similarity:157/405 - (38%) Gaps:71/405 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DEEMESELENVLYE-----ESAQQAKGVVGLEDFSSELLPDSEGVLDEDDFPLDAEPTQFSLSED 230
            |...:|:.|.|:.|     |..:..:.::..:|..|   ..||.:.......:|.:.......|.
  Fly   102 DHNEDSDDERVVLEKQDEDEDERPGRSIIKWQDHQS---LTSESLRQVRALKVDYKEEDSEQEEC 163

  Fly   231 ELDLDRDTEKDFALEQNKSCNEIISIRKCKTKEEIGKVDHGAKVY---KVVLGEYNSLKETAPKY 292
            .::||.|:|...:.:...||                  .|..|||   ||:  |.:.:::  .|.
  Fly   164 GMELDLDSEGRHSAKIPHSC------------------PHCTKVYQSRKVL--ERHIMRQ--HKD 206

  Fly   293 SLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHLLR-HNRAKN----- 351
            :||    |.:.....:....:...:::....|.|:.||..:..:..|:.||.| |:..:.     
  Fly   207 TLS----PDVDSEDADYEPPKDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAI 267

  Fly   352 FECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRH------ERDV---H-GA 406
            |.|.||..:...|...:.|:...|.|.   .|..|...:.......||      ||:|   | |.
  Fly   268 FTCLECEAQLPRLRLLDEHMVQAHGGA---ACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGC 329

  Fly   407 GNRIRT----RVKSKEEGSSRHY-CTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSA 466
            |.|..|    |...|.....::: |..|..|..:|:.|.:|:..|.|.|||.|::|..:|...|.
  Fly   330 GKRFFTIRHMRNHGKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSG 394

  Fly   467 MKRHQALHD-KFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDL 530
            ::.|.|:|. :.|..|.:|...|..:..|..|:.:|.......|::|...|.....|..|     
  Fly   395 LREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGH----- 454

  Fly   531 HRDNMQKAIKEEVNG 545
                |:|...:|:||
  Fly   455 ----MRKHRNDELNG 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 61/226 (27%)
zf-C2H2 324..346 CDD:278523 8/22 (36%)
C2H2 Zn finger 326..346 CDD:275368 7/20 (35%)
C2H2 Zn finger 354..375 CDD:275368 5/20 (25%)
C2H2 Zn finger 383..401 CDD:275368 4/23 (17%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..501 CDD:275368 5/19 (26%)
C2H2 Zn finger 509..528 CDD:275368 5/18 (28%)
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 4/19 (21%)
zf-C2H2_8 323..411 CDD:292531 26/87 (30%)
C2H2 Zn finger 327..346 CDD:275368 6/18 (33%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 367..389 CDD:290200 9/21 (43%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-H2C2_2 395..419 CDD:290200 7/23 (30%)
C2H2 Zn finger 410..430 CDD:275368 5/19 (26%)
C2H2 Zn finger 438..458 CDD:275368 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.