DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and CG3847

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_572317.2 Gene:CG3847 / 31577 FlyBaseID:FBgn0029867 Length:380 Species:Drosophila melanogaster


Alignment Length:400 Identity:79/400 - (19%)
Similarity:149/400 - (37%) Gaps:89/400 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 RAKCQQVDKKLRQTTEKYNIQICDEEMESELENVLYEESAQQAK---------------GVVGLE 197
            |.|...|.:::.....:.:.::..||...|.|..:.|:..|:.:               .||.|.
  Fly     5 RVKYSMVKEEIVPVLIEQDTEVDPEEEPEEDEEHVQEDDGQETQYTYAYTTGDDDDTETAVVTLS 69

  Fly   198 DFSSELLPDSEGV-LDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFALEQNKSCNEIISI----- 256
            |...|.|.::|.| :||:.         .:::..|| ::..|.::..:||....:.|:.|     
  Fly    70 DRDHEALVNAEEVIIDENG---------HAVTLQEL-VENSTVEEETIEQGDGTHTILHIVPNIH 124

  Fly   257 -------------RKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEE 308
                         .:.:..:|...|||.....:|...|..|:     .:..::....|   .|..
  Fly   125 GEEVEEDEELEDGEEVEHDDEFVTVDHEGGELEVEDDEVGSI-----VFESTIDHAEQ---DPYG 181

  Fly   309 KNRRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHLLRHNRAKN------FECPECPKKFYDL-YT 366
            :|:           .:.|..||:.:.....|::|:....|.:|      .:|..|.|.|..: |.
  Fly   182 RNK-----------TFYCPNCGNCYSAAGSLKLHMRACLRQRNEISTDERKCKVCSKVFNSVAYL 235

  Fly   367 RNIHVRALHKGEHPFPCNHCNESFANAS------SRHRHERDVHGAGNRIRTRVKSKEEGSSRHY 425
            :...:|  |.||.||.|..|...|...|      ..|:|:..:......:..:...|:.......
  Fly   236 KEHMMR--HTGEQPFRCTRCYRKFVEESKFTAHMESHKHQDKLEAEAVALAAQHGGKKVVVKEFQ 298

  Fly   426 CTQCTKSYTSKKGLVLHMNFHNG--SRPFQCKICQMKFADPSAMKRH-QALHDKFPIRCDICLKG 487
            |..|::::|        :.|..|  .|.:.|..|:.|:::..|:::| |.:.:|....|..|.:.
  Fly   299 CAFCSQNFT--------VVFDVGQVKRRYACDACRDKYSNAEALRQHKQQVEEKREFSCVRCGRK 355

  Fly   488 FLLRSQLTKH 497
            |:....|.:|
  Fly   356 FVFEGFLQRH 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 3/11 (27%)
COG5048 <323..528 CDD:227381 42/190 (22%)
zf-C2H2 324..346 CDD:278523 5/21 (24%)
C2H2 Zn finger 326..346 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..375 CDD:275368 6/21 (29%)
C2H2 Zn finger 383..401 CDD:275368 6/23 (26%)
C2H2 Zn finger 426..446 CDD:275368 3/19 (16%)
C2H2 Zn finger 454..474 CDD:275368 6/20 (30%)
C2H2 Zn finger 481..501 CDD:275368 4/16 (25%)
C2H2 Zn finger 509..528 CDD:275368
CG3847NP_572317.2 C2H2 Zn finger 188..216 CDD:275368 7/27 (26%)
C2H2 Zn finger 222..242 CDD:275368 6/21 (29%)
C2H2 Zn finger 250..270 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.