DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and mld

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:86/233 - (36%) Gaps:50/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 IHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSY 433
            :.|..|....|   |.:|.|.|.|..|..:|.:..|||..            :..:.||.|.:.|
  Fly  1714 VQVSELRTSHH---CLYCEERFTNEISLKKHHQLAHGALT------------TMPYVCTICKRGY 1763

  Fly   434 TSKKGLVLHMNFHN-GSRPFQCKICQMKFADP-----------------------------SAMK 468
            ..:..|..||..|: ..||::|.||:::|..|                             ||:|
  Fly  1764 RMRTALHRHMESHDVEGRPYECNICRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALK 1828

  Fly   469 RHQALHDKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHRD 533
            .|...|.:...:||.|.:.|....:|.||:..|:.|. ::|:.|...:....|...|..|.|...
  Fly  1829 THIKFHGELGYQCDGCDRTFEYLKELRKHRRTHSEMF-YKCKFCPSSFMRFTNFRAHMKTHLPLG 1892

  Fly   534 ---NMQKAIKEEVNGLQQAFKD-IDKEMDFESQTPMQP 567
               |...|.|...|....|..| ::.......:||:.|
  Fly  1893 VFRNEDAASKSPSNNNSHASSDKLENPATPIEETPLTP 1930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 46/188 (24%)
zf-C2H2 324..346 CDD:278523
C2H2 Zn finger 326..346 CDD:275368
C2H2 Zn finger 354..375 CDD:275368 1/5 (20%)
C2H2 Zn finger 383..401 CDD:275368 7/17 (41%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
C2H2 Zn finger 454..474 CDD:275368 9/48 (19%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..528 CDD:275368 4/18 (22%)
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 7/20 (35%)
C2H2 Zn finger 1756..1776 CDD:275368 7/19 (37%)
C2H2 Zn finger 1785..1806 CDD:275368 5/20 (25%)
C2H2 Zn finger 1814..1834 CDD:275368 4/19 (21%)
zf-C2H2 1839..1861 CDD:278523 7/21 (33%)
C2H2 Zn finger 1841..1861 CDD:275368 7/19 (37%)
C2H2 Zn finger 1868..1888 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439965
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.