DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and ZNF281

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001268222.1 Gene:ZNF281 / 23528 HGNCID:13075 Length:895 Species:Homo sapiens


Alignment Length:187 Identity:48/187 - (25%)
Similarity:77/187 - (41%) Gaps:32/187 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 LHKGEHPFPCNHCNESFANASSR----HRHERDVHGAGNRIRTRVKSKEEG---------SSR-- 423
            ||:.....|..|..:...::|||    |..|........:...|.|.:.:|         ||:  
Human   180 LHQHVQQQPAQHHRDVLLSSSSRTDDHHGTEEPKQDTNVKKAKRPKPESQGIKAKRKPSASSKPS 244

  Fly   424 ----------------HYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQA 472
                            |.|..|:.::.|...|..|:..|.|.|||||..|.|.|.....::||:.
Human   245 LVGDGEGAILSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQKYLLQRHEK 309

  Fly   473 LHDK-FPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNT 528
            :|.: .|..||.|...|:.:..:.:|:..|:|..|::|:.|..::.....|.||:.|
Human   310 IHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHRRT 366

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 47/185 (25%)
zf-C2H2 324..346 CDD:278523
C2H2 Zn finger 326..346 CDD:275368