DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and M03D4.4

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:193 Identity:47/193 - (24%)
Similarity:78/193 - (40%) Gaps:45/193 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 CNHCNESFANASSRHRHERDVHGA---GNRIRTR----------VKSKEEGS------------- 421
            |..|:.:|.:.....||||:.|..   |::...|          :|.|.|.|             
 Worm     7 CRDCSGAFHSLDELQRHEREEHETVEQGDQEEDRMEDDSDELAMIKIKIEDSDFLSDTDSSQLSM 71

  Fly   422 --------------SRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQA 472
                          .|:.|..|.:.:..|:.|..||..|:|.:|..|..|..:|.....:|:|..
 Worm    72 NPTTPSEKSSSGEKGRYECEDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKHWM 136

  Fly   473 LH--DKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHRD 533
            .|  ::..: |..|.|.|..:..||:|..:|:|..||.|..|...:..:::||:|..  :|::
 Worm   137 WHTGERSHV-CPHCNKAFFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHMK--IHQE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 46/186 (25%)
zf-C2H2 324..346 CDD:278523
C2H2 Zn finger 326..346 CDD:275368
C2H2 Zn finger 354..375 CDD:275368
C2H2 Zn finger 383..401 CDD:275368 5/17 (29%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..528 CDD:275368 5/18 (28%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 6/19 (32%)
zf-H2C2_2 102..127 CDD:290200 9/24 (38%)
C2H2 Zn finger 118..138 CDD:275368 5/19 (26%)
C2H2 Zn finger 146..166 CDD:275368 7/19 (37%)
zf-H2C2_2 158..181 CDD:290200 9/22 (41%)
zf-C2H2 172..194 CDD:278523 6/23 (26%)
C2H2 Zn finger 174..194 CDD:275368 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.