Sequence 1: | NP_001303488.1 | Gene: | CG17803 / 42141 | FlyBaseID: | FBgn0038547 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_493611.2 | Gene: | klu-1 / 173366 | WormBaseID: | WBGene00013970 | Length: | 543 | Species: | Caenorhabditis elegans |
Alignment Length: | 327 | Identity: | 65/327 - (19%) |
---|---|---|---|
Similarity: | 100/327 - (30%) | Gaps: | 130/327 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 282 YNSLKETAPKYSLSLPKKPQLRVSPEEKN----RRRRERIQAKPLNYVCDKCGHTFRQRSQLQMH 342
Fly 343 LLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAG 407
Fly 408 NRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQA 472
Fly 473 LHDKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHRDN--- 534
Fly 535 ----MQKAIK-----------------EEVNGLQQAFKDI---------DKEMDFES---QTPMQ 566
Fly 567 PN 568 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17803 | NP_001303488.1 | zf-AD | 86..160 | CDD:214871 | |
COG5048 | <323..528 | CDD:227381 | 39/204 (19%) | ||
zf-C2H2 | 324..346 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 326..346 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 354..375 | CDD:275368 | 0/20 (0%) | ||
C2H2 Zn finger | 383..401 | CDD:275368 | 4/17 (24%) | ||
C2H2 Zn finger | 426..446 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 454..474 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 481..501 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 509..528 | CDD:275368 | 4/18 (22%) | ||
klu-1 | NP_493611.2 | C2H2 Zn finger | 334..354 | CDD:275368 | 6/69 (9%) |
zf-C2H2 | 369..391 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 371..391 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 383..408 | CDD:290200 | 9/41 (22%) | ||
COG5048 | 395..>448 | CDD:227381 | 17/79 (22%) | ||
C2H2 Zn finger | 399..419 | CDD:275368 | 7/46 (15%) | ||
zf-H2C2_2 | 411..436 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 427..447 | CDD:275368 | 4/19 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |