DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and Y53H1A.2

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001122547.1 Gene:Y53H1A.2 / 173016 WormBaseID:WBGene00013178 Length:214 Species:Caenorhabditis elegans


Alignment Length:184 Identity:42/184 - (22%)
Similarity:76/184 - (41%) Gaps:38/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 NYVCDKCG----HTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPC 383
            ||..|:.|    .|.|       ::....:...:|.      .||..::|:......|.::..|.
 Worm    37 NYTSDEDGPKVLTTMR-------NMFAEQKTDEYEL------VYDNNSQNVPQNCSPKNQYSPPQ 88

  Fly   384 NHCNESFANASSRHRHERDVHGAGNRIRTRV---KSK-----------EEGSS--RHYCTQCTKS 432
            :.....::|.|  |.|.|:...:...:..||   ||:           |:|.|  :|.|.:|.|.
 Worm    89 SVQQAHYSNLS--HFHPRNPEFSQEIVENRVISPKSEHPEEIEDHEDDEDGQSEMKHNCPECPKK 151

  Fly   433 YTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALH---DKFPIRCDI 483
            |||::.|..|:..|.....::|:.|...:..|.:::||....   |:||.:.::
 Worm   152 YTSERRLKHHIVVHRNPDAYKCQKCGYCYQSPDSLRRHWKKTPNCDEFPPKINV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 42/184 (23%)
zf-C2H2 324..346 CDD:278523 5/25 (20%)
C2H2 Zn finger 326..346 CDD:275368 4/23 (17%)
C2H2 Zn finger 354..375 CDD:275368 3/20 (15%)
C2H2 Zn finger 383..401 CDD:275368 4/17 (24%)
C2H2 Zn finger 426..446 CDD:275368 8/19 (42%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 0/3 (0%)
C2H2 Zn finger 509..528 CDD:275368
Y53H1A.2NP_001122547.1 C2H2 Zn finger 145..165 CDD:275368 8/19 (42%)
C2H2 Zn finger 173..189 CDD:275368 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.